Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XCQ5

Protein Details
Accession A0A317XCQ5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-54AGEKDFSAKKRKRKRERKWAPHSRRMLGBasic
NLS Segment(s)
PositionSequence
34-50AKKRKRKRERKWAPHSR
Subcellular Location(s) plas 10, mito 8, extr 5, nucl 1, cyto 1, cyto_nucl 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MRPTSSYILGAIIIIVPVLYHQPAQSAGEKDFSAKKRKRKRERKWAPHSRRMLGVSNLEGWLVYPQDSHSTLVAWLQLQDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.05
6 0.05
7 0.06
8 0.06
9 0.07
10 0.09
11 0.12
12 0.15
13 0.16
14 0.16
15 0.18
16 0.18
17 0.19
18 0.24
19 0.26
20 0.32
21 0.36
22 0.46
23 0.54
24 0.66
25 0.75
26 0.8
27 0.86
28 0.87
29 0.93
30 0.94
31 0.94
32 0.95
33 0.93
34 0.91
35 0.86
36 0.76
37 0.69
38 0.61
39 0.54
40 0.45
41 0.38
42 0.3
43 0.26
44 0.24
45 0.19
46 0.16
47 0.12
48 0.11
49 0.09
50 0.08
51 0.07
52 0.08
53 0.12
54 0.14
55 0.15
56 0.14
57 0.14
58 0.14
59 0.15
60 0.16
61 0.12