Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WU48

Protein Details
Accession A0A317WU48    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-34GHAICLRSKIKNNKKKKNNNNTTLTNLHydrophilic
NLS Segment(s)
PositionSequence
21-22KK
Subcellular Location(s) extr 8, mito 4, golg 4, plas 3, E.R. 3, vacu 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MSRFSDFGHAICLRSKIKNNKKKKNNNNTTLTNLVGRGFLACLPACLLACPSACLAAYLLTIYCDLSDNLSPSRMRLCVFGRFHFRGPVVTDFDRSPDGLDLLGCSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.41
3 0.45
4 0.55
5 0.64
6 0.73
7 0.78
8 0.86
9 0.91
10 0.93
11 0.93
12 0.93
13 0.92
14 0.88
15 0.81
16 0.76
17 0.67
18 0.57
19 0.46
20 0.36
21 0.27
22 0.2
23 0.15
24 0.1
25 0.08
26 0.07
27 0.08
28 0.07
29 0.07
30 0.08
31 0.08
32 0.08
33 0.07
34 0.08
35 0.07
36 0.07
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.08
55 0.1
56 0.1
57 0.13
58 0.13
59 0.13
60 0.15
61 0.15
62 0.15
63 0.17
64 0.2
65 0.26
66 0.29
67 0.33
68 0.39
69 0.41
70 0.42
71 0.42
72 0.39
73 0.33
74 0.34
75 0.34
76 0.32
77 0.3
78 0.31
79 0.27
80 0.29
81 0.28
82 0.24
83 0.21
84 0.17
85 0.16
86 0.14
87 0.13