Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NYY1

Protein Details
Accession A8NYY1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-139LDLYVIQKRIRQRKKRRNPLVLLDSEDHydrophilic
NLS Segment(s)
PositionSequence
120-129KRIRQRKKRR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
KEGG cci:CC1G_01468  -  
Amino Acid Sequences MMTPSLSGLPSLKSGADKLTWITVPYRRRMELDDDESSADSVPSPSEDRDSEMSLDESLSEDDSNGASGANLNGSHPKEVGLPKGQPIHSPALDENSDARRMDTDSDKENIPLDLYVIQKRIRQRKKRRNPLVLLDSEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.16
5 0.16
6 0.19
7 0.18
8 0.18
9 0.21
10 0.25
11 0.29
12 0.36
13 0.39
14 0.37
15 0.39
16 0.41
17 0.44
18 0.45
19 0.45
20 0.4
21 0.36
22 0.35
23 0.33
24 0.3
25 0.22
26 0.15
27 0.09
28 0.07
29 0.06
30 0.07
31 0.09
32 0.09
33 0.12
34 0.12
35 0.15
36 0.17
37 0.18
38 0.16
39 0.16
40 0.16
41 0.13
42 0.12
43 0.09
44 0.08
45 0.07
46 0.07
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.09
61 0.09
62 0.1
63 0.1
64 0.1
65 0.13
66 0.14
67 0.18
68 0.17
69 0.17
70 0.2
71 0.25
72 0.25
73 0.23
74 0.25
75 0.27
76 0.23
77 0.24
78 0.22
79 0.21
80 0.21
81 0.2
82 0.19
83 0.17
84 0.19
85 0.17
86 0.17
87 0.14
88 0.15
89 0.18
90 0.21
91 0.21
92 0.22
93 0.24
94 0.24
95 0.24
96 0.24
97 0.21
98 0.16
99 0.13
100 0.11
101 0.13
102 0.15
103 0.17
104 0.2
105 0.22
106 0.25
107 0.35
108 0.45
109 0.52
110 0.6
111 0.69
112 0.77
113 0.86
114 0.93
115 0.95
116 0.95
117 0.92
118 0.91
119 0.89
120 0.81