Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317VPP5

Protein Details
Accession A0A317VPP5    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
56-89GGRGREERRKKNGRGRRRRRRRRRSRGNEEEGGRBasic
NLS Segment(s)
PositionSequence
32-82GRGKRWRDPGNWEDEERGGREGRGGGRGREERRKKNGRGRRRRRRRRRSRG
110-127RRGGRGGGREEEERKKTR
Subcellular Location(s) nucl 15, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MVMNLRNPGRGAGIEWADGEGKEERFRGVFGGRGKRWRDPGNWEDEERGGREGRGGGRGREERRKKNGRGRRRRRRRRRSRGNEEEGGRGDGSGEEVVVGSEQEEKVEERRGGRGGGREEEERKKTREEVRGKSSQSWLAGPSGLVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.17
5 0.16
6 0.17
7 0.14
8 0.14
9 0.16
10 0.16
11 0.17
12 0.16
13 0.17
14 0.17
15 0.15
16 0.19
17 0.24
18 0.33
19 0.35
20 0.42
21 0.46
22 0.49
23 0.55
24 0.55
25 0.52
26 0.51
27 0.53
28 0.53
29 0.52
30 0.48
31 0.43
32 0.39
33 0.36
34 0.28
35 0.25
36 0.17
37 0.14
38 0.14
39 0.14
40 0.14
41 0.19
42 0.19
43 0.18
44 0.24
45 0.31
46 0.35
47 0.43
48 0.5
49 0.51
50 0.6
51 0.68
52 0.7
53 0.74
54 0.79
55 0.8
56 0.83
57 0.86
58 0.87
59 0.9
60 0.94
61 0.95
62 0.96
63 0.96
64 0.96
65 0.97
66 0.96
67 0.96
68 0.95
69 0.9
70 0.85
71 0.75
72 0.67
73 0.56
74 0.47
75 0.35
76 0.25
77 0.18
78 0.11
79 0.1
80 0.07
81 0.06
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.05
89 0.05
90 0.06
91 0.07
92 0.08
93 0.1
94 0.16
95 0.18
96 0.17
97 0.21
98 0.22
99 0.23
100 0.25
101 0.29
102 0.28
103 0.3
104 0.32
105 0.33
106 0.37
107 0.44
108 0.48
109 0.47
110 0.46
111 0.46
112 0.5
113 0.54
114 0.58
115 0.59
116 0.61
117 0.64
118 0.69
119 0.69
120 0.66
121 0.62
122 0.57
123 0.5
124 0.43
125 0.36
126 0.3
127 0.27