Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317VDS1

Protein Details
Accession A0A317VDS1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-84PITKNTMEKRKVKRREEKKRRRGSNYIPDPNPBasic
NLS Segment(s)
PositionSequence
61-75KRKVKRREEKKRRRG
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MGTFASTSYGTGYIPPYSHTHKHTSVHAYMHAYRVLILLPTLSAMHQEKINNPITKNTMEKRKVKRREEKKRRRGSNYIPDPNPTSSSPSLSPHARTIIIPSLCVARRSICTPYETS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.18
4 0.25
5 0.3
6 0.32
7 0.37
8 0.4
9 0.42
10 0.46
11 0.48
12 0.44
13 0.41
14 0.4
15 0.38
16 0.34
17 0.34
18 0.28
19 0.22
20 0.19
21 0.17
22 0.14
23 0.09
24 0.08
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.07
31 0.09
32 0.1
33 0.12
34 0.13
35 0.14
36 0.19
37 0.26
38 0.25
39 0.25
40 0.27
41 0.27
42 0.28
43 0.31
44 0.3
45 0.33
46 0.37
47 0.45
48 0.52
49 0.6
50 0.68
51 0.73
52 0.79
53 0.81
54 0.86
55 0.9
56 0.91
57 0.91
58 0.92
59 0.91
60 0.89
61 0.86
62 0.85
63 0.84
64 0.83
65 0.81
66 0.71
67 0.65
68 0.61
69 0.54
70 0.48
71 0.38
72 0.33
73 0.26
74 0.28
75 0.27
76 0.26
77 0.29
78 0.29
79 0.31
80 0.28
81 0.29
82 0.27
83 0.25
84 0.26
85 0.3
86 0.27
87 0.25
88 0.23
89 0.27
90 0.27
91 0.28
92 0.25
93 0.2
94 0.24
95 0.27
96 0.31
97 0.28