Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8PH21

Protein Details
Accession A8PH21    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSPDEPKTPRRKEKAKTVYVSPHydrophilic
277-298ELSPPPTPPPSPRKRPKKSDSSHydrophilic
NLS Segment(s)
PositionSequence
287-294SPRKRPKK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR045138  MeCP2/MBD4  
Gene Ontology GO:0005634  C:nucleus  
GO:0003824  F:catalytic activity  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
KEGG cci:CC1G_11852  -  
Amino Acid Sequences MSPDEPKTPRRKEKAKTVYVSPYFSPVLKSGEAHWHPEPRKSPPKECLPEPLTCEERMGLGEPPGEDPLALFYHRKFERLFNDLEGLKPKLIQETVADDPWKLLVAVTLLNKTTGRAAIPVFWKIMERWSTPFLLSQATEQDLVIMLTPLGTQRIRAQRLKEMSRLYLLDRPSVYDPRTSRATLPSVPGSPKKRRKYPDTPISHLPGAGAYALDSYRIFCSLHDDPASTEWRQVLPTDKELIRYLVGPPVRNPYPKSELDGPGSPITVAYLRALIQELSPPPTPPPSPRKRPKKSDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.82
4 0.78
5 0.78
6 0.72
7 0.67
8 0.57
9 0.51
10 0.42
11 0.38
12 0.34
13 0.26
14 0.26
15 0.23
16 0.23
17 0.22
18 0.31
19 0.32
20 0.35
21 0.37
22 0.42
23 0.43
24 0.5
25 0.52
26 0.51
27 0.6
28 0.62
29 0.65
30 0.64
31 0.73
32 0.71
33 0.69
34 0.69
35 0.62
36 0.59
37 0.55
38 0.53
39 0.45
40 0.39
41 0.37
42 0.27
43 0.24
44 0.21
45 0.19
46 0.14
47 0.12
48 0.13
49 0.13
50 0.14
51 0.14
52 0.13
53 0.11
54 0.1
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.2
61 0.21
62 0.23
63 0.23
64 0.28
65 0.32
66 0.35
67 0.36
68 0.29
69 0.33
70 0.3
71 0.31
72 0.28
73 0.24
74 0.2
75 0.19
76 0.18
77 0.17
78 0.17
79 0.16
80 0.14
81 0.17
82 0.19
83 0.2
84 0.2
85 0.17
86 0.17
87 0.16
88 0.15
89 0.09
90 0.07
91 0.05
92 0.05
93 0.08
94 0.09
95 0.1
96 0.1
97 0.11
98 0.11
99 0.11
100 0.12
101 0.1
102 0.09
103 0.09
104 0.1
105 0.13
106 0.15
107 0.15
108 0.14
109 0.14
110 0.14
111 0.13
112 0.18
113 0.17
114 0.16
115 0.18
116 0.2
117 0.2
118 0.2
119 0.21
120 0.16
121 0.14
122 0.13
123 0.11
124 0.1
125 0.11
126 0.1
127 0.09
128 0.08
129 0.07
130 0.07
131 0.06
132 0.05
133 0.03
134 0.03
135 0.03
136 0.03
137 0.05
138 0.05
139 0.06
140 0.12
141 0.2
142 0.24
143 0.28
144 0.3
145 0.35
146 0.41
147 0.43
148 0.42
149 0.37
150 0.33
151 0.32
152 0.31
153 0.26
154 0.24
155 0.22
156 0.2
157 0.18
158 0.19
159 0.2
160 0.23
161 0.21
162 0.23
163 0.23
164 0.24
165 0.28
166 0.26
167 0.25
168 0.25
169 0.28
170 0.24
171 0.26
172 0.24
173 0.23
174 0.26
175 0.31
176 0.35
177 0.42
178 0.5
179 0.56
180 0.62
181 0.67
182 0.73
183 0.77
184 0.8
185 0.8
186 0.78
187 0.75
188 0.71
189 0.68
190 0.59
191 0.48
192 0.38
193 0.27
194 0.2
195 0.14
196 0.09
197 0.05
198 0.05
199 0.05
200 0.06
201 0.06
202 0.07
203 0.08
204 0.09
205 0.09
206 0.08
207 0.16
208 0.17
209 0.21
210 0.21
211 0.21
212 0.21
213 0.24
214 0.28
215 0.21
216 0.21
217 0.18
218 0.18
219 0.18
220 0.19
221 0.23
222 0.23
223 0.26
224 0.3
225 0.29
226 0.31
227 0.32
228 0.32
229 0.25
230 0.22
231 0.2
232 0.21
233 0.23
234 0.22
235 0.23
236 0.29
237 0.33
238 0.36
239 0.38
240 0.39
241 0.43
242 0.43
243 0.47
244 0.46
245 0.46
246 0.47
247 0.47
248 0.43
249 0.38
250 0.36
251 0.3
252 0.22
253 0.2
254 0.16
255 0.14
256 0.1
257 0.11
258 0.11
259 0.12
260 0.13
261 0.12
262 0.11
263 0.16
264 0.17
265 0.2
266 0.22
267 0.22
268 0.23
269 0.29
270 0.32
271 0.36
272 0.44
273 0.5
274 0.6
275 0.7
276 0.78
277 0.83
278 0.9