Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316W1L4

Protein Details
Accession A0A316W1L4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-81LGSADRPSSSHRRKQRKLCKLPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, plas 6, mito 2
Family & Domain DBs
Amino Acid Sequences MFMIAIGAIFTIQVRALCTAATFVIDGAPHALATRMANHSSDLQDSIDIIQASSRPSDVLGSADRPSSSHRRKQRKLCKLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.08
8 0.08
9 0.07
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.09
22 0.1
23 0.11
24 0.11
25 0.12
26 0.13
27 0.13
28 0.13
29 0.11
30 0.09
31 0.09
32 0.08
33 0.08
34 0.09
35 0.08
36 0.07
37 0.07
38 0.07
39 0.08
40 0.09
41 0.08
42 0.06
43 0.07
44 0.08
45 0.08
46 0.09
47 0.11
48 0.13
49 0.14
50 0.15
51 0.15
52 0.15
53 0.21
54 0.29
55 0.36
56 0.43
57 0.53
58 0.63
59 0.72
60 0.83
61 0.88