Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VY57

Protein Details
Accession A0A316VY57   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-50VSSTTLHDRRVPRRKQKKKAKRDLAIQRKHSBasic
NLS Segment(s)
PositionSequence
28-68RRVPRRKQKKKAKRDLAIQRKHSKLSIARSLAKGHRNRQGS
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MRDEKERACMHAAPPNHTVVSSTTLHDRRVPRRKQKKKAKRDLAIQRKHSKLSIARSLAKGHRNRQGSRVRGASVLQHTRQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.3
4 0.27
5 0.25
6 0.2
7 0.22
8 0.18
9 0.17
10 0.22
11 0.24
12 0.26
13 0.3
14 0.35
15 0.41
16 0.5
17 0.58
18 0.62
19 0.71
20 0.81
21 0.86
22 0.91
23 0.91
24 0.92
25 0.94
26 0.93
27 0.88
28 0.87
29 0.87
30 0.86
31 0.83
32 0.8
33 0.76
34 0.68
35 0.64
36 0.54
37 0.49
38 0.44
39 0.42
40 0.43
41 0.4
42 0.41
43 0.41
44 0.45
45 0.45
46 0.48
47 0.48
48 0.47
49 0.5
50 0.53
51 0.54
52 0.58
53 0.62
54 0.58
55 0.59
56 0.56
57 0.5
58 0.45
59 0.44
60 0.42
61 0.41
62 0.44