Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RPT5

Protein Details
Accession D6RPT5    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-36LMKQRREKRLFKCFRKGRGCSBasic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 10.5, nucl 6.5, mito 4
Family & Domain DBs
KEGG cci:CC1G_15202  -  
Amino Acid Sequences MALNVKADVVLQREALMKQRREKRLFKCFRKGRGCSRRFDIPSRLFMEKSSVDYLAQVTPGDTGEEAKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.25
3 0.31
4 0.33
5 0.4
6 0.5
7 0.58
8 0.63
9 0.7
10 0.71
11 0.74
12 0.79
13 0.78
14 0.8
15 0.78
16 0.81
17 0.81
18 0.77
19 0.77
20 0.77
21 0.73
22 0.66
23 0.63
24 0.62
25 0.56
26 0.55
27 0.53
28 0.45
29 0.47
30 0.47
31 0.45
32 0.37
33 0.34
34 0.34
35 0.26
36 0.26
37 0.23
38 0.19
39 0.17
40 0.17
41 0.19
42 0.15
43 0.14
44 0.11
45 0.09
46 0.09
47 0.09
48 0.1
49 0.08
50 0.11