Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VQC7

Protein Details
Accession A0A316VQC7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-44QTPKVEKQEKPKQPKGRANKRNLYNRRFHydrophilic
NLS Segment(s)
PositionSequence
12-37GKVKSQTPKVEKQEKPKQPKGRANKR
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRANKRNLYNRRFVNVVVGPGGKRRANAQGVVCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.46
4 0.5
5 0.53
6 0.62
7 0.65
8 0.71
9 0.69
10 0.72
11 0.75
12 0.76
13 0.79
14 0.79
15 0.79
16 0.79
17 0.83
18 0.83
19 0.84
20 0.83
21 0.83
22 0.82
23 0.8
24 0.81
25 0.81
26 0.76
27 0.72
28 0.66
29 0.6
30 0.53
31 0.44
32 0.41
33 0.33
34 0.29
35 0.23
36 0.22
37 0.19
38 0.22
39 0.27
40 0.22
41 0.21
42 0.23
43 0.29
44 0.32
45 0.37
46 0.37