Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NA43

Protein Details
Accession A8NA43    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
114-139WGAQVNVREHRRRRRGKKDAAPAVTKHydrophilic
NLS Segment(s)
PositionSequence
123-132HRRRRRGKKD
158-162RRRRR
Subcellular Location(s) cyto 11.5, cyto_nucl 7.5, mito 5, extr 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021740  Velvet  
IPR037525  Velvet_dom  
IPR038491  Velvet_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG cci:CC1G_12219  -  
Pfam View protein in Pfam  
PF11754  Velvet  
PROSITE View protein in PROSITE  
PS51821  VELVET  
Amino Acid Sequences MSNTDAQTSFASLVVGPPVTDPINPLMGATSISPNLIELHGRKALVFAFGNLAVRAEGDFVLRYRVADILAGTGIDGVFPIQAICYGGPFHVFSTKDFPGYEASTELTKTLSVWGAQVNVREHRRRRRGKKDAAPAVTKPLYTTAPLDRDIVADSERRRRRRAGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.09
4 0.09
5 0.11
6 0.12
7 0.12
8 0.12
9 0.13
10 0.15
11 0.15
12 0.14
13 0.12
14 0.11
15 0.12
16 0.12
17 0.11
18 0.09
19 0.1
20 0.1
21 0.09
22 0.1
23 0.1
24 0.12
25 0.11
26 0.15
27 0.17
28 0.17
29 0.17
30 0.17
31 0.16
32 0.17
33 0.16
34 0.12
35 0.12
36 0.12
37 0.13
38 0.12
39 0.12
40 0.08
41 0.08
42 0.08
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.09
49 0.08
50 0.09
51 0.08
52 0.09
53 0.08
54 0.08
55 0.08
56 0.06
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.06
76 0.06
77 0.07
78 0.1
79 0.11
80 0.12
81 0.17
82 0.18
83 0.18
84 0.18
85 0.18
86 0.17
87 0.17
88 0.17
89 0.12
90 0.12
91 0.12
92 0.12
93 0.11
94 0.08
95 0.07
96 0.07
97 0.08
98 0.08
99 0.07
100 0.08
101 0.09
102 0.11
103 0.12
104 0.16
105 0.17
106 0.23
107 0.3
108 0.37
109 0.45
110 0.54
111 0.63
112 0.7
113 0.78
114 0.83
115 0.87
116 0.89
117 0.91
118 0.91
119 0.9
120 0.86
121 0.8
122 0.7
123 0.67
124 0.57
125 0.47
126 0.37
127 0.31
128 0.26
129 0.23
130 0.25
131 0.23
132 0.25
133 0.26
134 0.27
135 0.24
136 0.23
137 0.23
138 0.21
139 0.17
140 0.19
141 0.23
142 0.32
143 0.41
144 0.46
145 0.5