Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316W4P2

Protein Details
Accession A0A316W4P2    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-75RRQCVVKKCACKRRRSLQRSARIAKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MGPSFLLALLAGQCSRVLRAWHLMHARSGEQDPRGLDADECAKTKGSAARRQCVVKKCACKRRRSLQRSARIAKSNEVHRAACSRARATAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.13
4 0.14
5 0.15
6 0.24
7 0.25
8 0.31
9 0.35
10 0.34
11 0.33
12 0.33
13 0.31
14 0.25
15 0.26
16 0.23
17 0.19
18 0.21
19 0.19
20 0.19
21 0.19
22 0.17
23 0.15
24 0.13
25 0.16
26 0.16
27 0.16
28 0.14
29 0.13
30 0.12
31 0.14
32 0.18
33 0.19
34 0.25
35 0.29
36 0.33
37 0.36
38 0.4
39 0.45
40 0.46
41 0.46
42 0.46
43 0.52
44 0.57
45 0.64
46 0.67
47 0.7
48 0.73
49 0.78
50 0.82
51 0.8
52 0.81
53 0.8
54 0.84
55 0.85
56 0.82
57 0.78
58 0.74
59 0.69
60 0.64
61 0.6
62 0.57
63 0.55
64 0.52
65 0.46
66 0.42
67 0.44
68 0.41
69 0.39
70 0.38
71 0.32
72 0.31