Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VVQ6

Protein Details
Accession A0A316VVQ6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-26TFRHIPRCFPAQRKSPPRDVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 5, extr 5, golg 4, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011330  Glyco_hydro/deAcase_b/a-brl  
IPR002509  NODB_dom  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0004099  F:chitin deacetylase activity  
GO:0071555  P:cell wall organization  
GO:0006032  P:chitin catabolic process  
GO:0000272  P:polysaccharide catabolic process  
Pfam View protein in Pfam  
PF01522  Polysacc_deac_1  
PROSITE View protein in PROSITE  
PS51677  NODB  
CDD cd10952  CE4_MrCDA_like  
Amino Acid Sequences MHAAGTFRHIPRCFPAQRKSPPRDVTPAAPTNEAQEAQIKSETEACTPYSIPEVANIKGQFPTIWQTADLVPGDSAAQSVWQNIQSQNIIPADIKPKGTPNGDFSSFTPTYDHSDPDCWWTFDNCVKPKHPKIPVDVYQCPEPSTWGLTFDDGPNCTQEVLYDFLQQQNQKATMFYIGSNILDWPLQAQRGLVDGHQICVHTWSHQYMTALSDTQVFSELYYTAKAIKDVVGVTPRCWRPPYGDTDDRVRAIATGLGLSTVIWTDDTDDWKAIPAGTLPKASIDANYASIINKESDTTGNIVLTHELNNGTMSEMIEQYPQIKQKFKHIVPITACMNETNPYPESITYPNFASYISGDIEPKGIPSGTDIKVQSASYDPLAAASATAAAGDSTGGSTSSSDKQASAQGQKSTGSGKSAASSNRAGKAIVAVSALGAVSAFMLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.62
4 0.72
5 0.79
6 0.81
7 0.82
8 0.8
9 0.77
10 0.76
11 0.71
12 0.66
13 0.65
14 0.63
15 0.56
16 0.51
17 0.45
18 0.41
19 0.4
20 0.34
21 0.26
22 0.25
23 0.24
24 0.24
25 0.27
26 0.24
27 0.21
28 0.27
29 0.27
30 0.23
31 0.24
32 0.22
33 0.21
34 0.21
35 0.21
36 0.19
37 0.18
38 0.16
39 0.2
40 0.22
41 0.21
42 0.27
43 0.27
44 0.25
45 0.25
46 0.25
47 0.19
48 0.18
49 0.23
50 0.18
51 0.19
52 0.17
53 0.19
54 0.18
55 0.22
56 0.2
57 0.15
58 0.13
59 0.12
60 0.13
61 0.1
62 0.1
63 0.06
64 0.08
65 0.07
66 0.09
67 0.11
68 0.13
69 0.16
70 0.16
71 0.2
72 0.19
73 0.19
74 0.22
75 0.21
76 0.2
77 0.17
78 0.2
79 0.23
80 0.24
81 0.25
82 0.22
83 0.26
84 0.3
85 0.33
86 0.32
87 0.32
88 0.35
89 0.36
90 0.36
91 0.32
92 0.36
93 0.33
94 0.31
95 0.26
96 0.22
97 0.26
98 0.25
99 0.27
100 0.2
101 0.22
102 0.23
103 0.27
104 0.28
105 0.23
106 0.23
107 0.22
108 0.24
109 0.26
110 0.34
111 0.33
112 0.36
113 0.41
114 0.49
115 0.55
116 0.61
117 0.64
118 0.6
119 0.61
120 0.66
121 0.68
122 0.66
123 0.63
124 0.57
125 0.53
126 0.49
127 0.43
128 0.33
129 0.28
130 0.21
131 0.2
132 0.17
133 0.15
134 0.15
135 0.15
136 0.16
137 0.17
138 0.18
139 0.15
140 0.16
141 0.14
142 0.14
143 0.13
144 0.12
145 0.1
146 0.09
147 0.12
148 0.12
149 0.13
150 0.14
151 0.16
152 0.2
153 0.2
154 0.2
155 0.2
156 0.21
157 0.18
158 0.18
159 0.16
160 0.15
161 0.15
162 0.13
163 0.12
164 0.11
165 0.11
166 0.1
167 0.1
168 0.08
169 0.07
170 0.07
171 0.06
172 0.07
173 0.08
174 0.07
175 0.07
176 0.07
177 0.09
178 0.1
179 0.08
180 0.12
181 0.12
182 0.13
183 0.14
184 0.14
185 0.12
186 0.14
187 0.14
188 0.1
189 0.11
190 0.12
191 0.12
192 0.13
193 0.13
194 0.12
195 0.13
196 0.12
197 0.11
198 0.1
199 0.11
200 0.09
201 0.09
202 0.1
203 0.08
204 0.08
205 0.08
206 0.08
207 0.06
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.08
214 0.08
215 0.09
216 0.09
217 0.1
218 0.14
219 0.14
220 0.15
221 0.22
222 0.22
223 0.23
224 0.24
225 0.24
226 0.24
227 0.28
228 0.34
229 0.35
230 0.39
231 0.38
232 0.43
233 0.44
234 0.38
235 0.34
236 0.27
237 0.18
238 0.14
239 0.13
240 0.08
241 0.06
242 0.05
243 0.05
244 0.05
245 0.05
246 0.04
247 0.03
248 0.03
249 0.03
250 0.04
251 0.06
252 0.08
253 0.1
254 0.11
255 0.11
256 0.11
257 0.12
258 0.12
259 0.09
260 0.08
261 0.08
262 0.11
263 0.12
264 0.13
265 0.12
266 0.12
267 0.14
268 0.14
269 0.13
270 0.11
271 0.1
272 0.11
273 0.11
274 0.11
275 0.1
276 0.11
277 0.11
278 0.1
279 0.09
280 0.09
281 0.09
282 0.1
283 0.11
284 0.12
285 0.11
286 0.11
287 0.11
288 0.11
289 0.11
290 0.11
291 0.1
292 0.1
293 0.1
294 0.09
295 0.1
296 0.09
297 0.09
298 0.09
299 0.08
300 0.08
301 0.09
302 0.09
303 0.09
304 0.09
305 0.1
306 0.13
307 0.19
308 0.21
309 0.27
310 0.27
311 0.37
312 0.47
313 0.46
314 0.53
315 0.5
316 0.54
317 0.51
318 0.55
319 0.47
320 0.38
321 0.38
322 0.28
323 0.26
324 0.2
325 0.18
326 0.17
327 0.15
328 0.15
329 0.16
330 0.16
331 0.18
332 0.21
333 0.22
334 0.19
335 0.2
336 0.19
337 0.18
338 0.18
339 0.16
340 0.12
341 0.13
342 0.13
343 0.13
344 0.12
345 0.13
346 0.14
347 0.13
348 0.12
349 0.12
350 0.1
351 0.09
352 0.12
353 0.19
354 0.19
355 0.25
356 0.25
357 0.25
358 0.28
359 0.28
360 0.25
361 0.21
362 0.21
363 0.16
364 0.17
365 0.14
366 0.13
367 0.13
368 0.12
369 0.09
370 0.07
371 0.06
372 0.05
373 0.05
374 0.05
375 0.04
376 0.04
377 0.04
378 0.04
379 0.04
380 0.05
381 0.05
382 0.05
383 0.07
384 0.1
385 0.14
386 0.18
387 0.18
388 0.18
389 0.2
390 0.26
391 0.32
392 0.36
393 0.38
394 0.38
395 0.39
396 0.4
397 0.39
398 0.37
399 0.32
400 0.27
401 0.23
402 0.21
403 0.22
404 0.27
405 0.28
406 0.29
407 0.33
408 0.35
409 0.38
410 0.38
411 0.35
412 0.31
413 0.32
414 0.29
415 0.23
416 0.18
417 0.13
418 0.12
419 0.13
420 0.12
421 0.07
422 0.06
423 0.04