Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NXA1

Protein Details
Accession A8NXA1    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
86-113TSKPMSKGAKKNAKRKEKKEKERAEAAABasic
NLS Segment(s)
PositionSequence
90-108MSKGAKKNAKRKEKKEKER
Subcellular Location(s) nucl 15, cyto 5, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
KEGG cci:CC1G_00245  -  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSLPPIDPKKSVAGIAVDPQTLERVVPESRRPDGSVRKQLKIRPGFTPQEDVQRFRGTRQAQADANKLPKGHIIGWAPPTASETSTSKPMSKGAKKNAKRKEKKEKERAEAAAAATPVRDNWEDDSDGEQPGAPTTAEEKKDPPPATTSESTDSVTNKLEKLTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.27
4 0.22
5 0.2
6 0.2
7 0.18
8 0.16
9 0.14
10 0.09
11 0.1
12 0.14
13 0.18
14 0.24
15 0.27
16 0.31
17 0.33
18 0.35
19 0.39
20 0.47
21 0.52
22 0.57
23 0.57
24 0.6
25 0.62
26 0.64
27 0.66
28 0.64
29 0.57
30 0.52
31 0.54
32 0.53
33 0.5
34 0.52
35 0.43
36 0.45
37 0.45
38 0.42
39 0.38
40 0.4
41 0.38
42 0.33
43 0.39
44 0.3
45 0.34
46 0.35
47 0.36
48 0.32
49 0.35
50 0.38
51 0.34
52 0.35
53 0.31
54 0.27
55 0.23
56 0.21
57 0.21
58 0.18
59 0.19
60 0.17
61 0.19
62 0.2
63 0.2
64 0.19
65 0.16
66 0.17
67 0.13
68 0.11
69 0.11
70 0.11
71 0.12
72 0.16
73 0.17
74 0.16
75 0.16
76 0.21
77 0.27
78 0.33
79 0.38
80 0.44
81 0.54
82 0.61
83 0.7
84 0.75
85 0.78
86 0.8
87 0.83
88 0.85
89 0.86
90 0.89
91 0.9
92 0.89
93 0.85
94 0.82
95 0.74
96 0.66
97 0.57
98 0.46
99 0.38
100 0.29
101 0.22
102 0.15
103 0.13
104 0.1
105 0.11
106 0.11
107 0.1
108 0.13
109 0.17
110 0.18
111 0.18
112 0.22
113 0.2
114 0.19
115 0.18
116 0.15
117 0.12
118 0.11
119 0.11
120 0.08
121 0.07
122 0.12
123 0.18
124 0.2
125 0.22
126 0.24
127 0.3
128 0.39
129 0.39
130 0.37
131 0.34
132 0.36
133 0.41
134 0.41
135 0.39
136 0.35
137 0.35
138 0.35
139 0.34
140 0.31
141 0.27
142 0.28
143 0.26
144 0.22