Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VYG5

Protein Details
Accession A0A316VYG5    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-36ASQHNQSRKAHRNGIKKPKTNKYPNLRGVNHydrophilic
NLS Segment(s)
PositionSequence
14-58RKAHRNGIKKPKTNKYPNLRGVNPKFLRNQRYAKHGTEKAVREAR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNASQHNQSRKAHRNGIKKPKTNKYPNLRGVNPKFLRNQRYAKHGTEKAVREARQGKREVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.77
4 0.75
5 0.75
6 0.76
7 0.82
8 0.82
9 0.8
10 0.82
11 0.82
12 0.84
13 0.83
14 0.82
15 0.8
16 0.8
17 0.81
18 0.78
19 0.71
20 0.71
21 0.65
22 0.66
23 0.58
24 0.52
25 0.5
26 0.5
27 0.53
28 0.5
29 0.54
30 0.47
31 0.53
32 0.55
33 0.53
34 0.55
35 0.54
36 0.53
37 0.53
38 0.53
39 0.54
40 0.56
41 0.52
42 0.51
43 0.56
44 0.59
45 0.59