Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NK15

Protein Details
Accession A8NK15    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-65FMSLHGKKSKKNRRHRSRAYYRRDKSTWBasic
NLS Segment(s)
PositionSequence
43-56GKKSKKNRRHRSRA
Subcellular Location(s) cysk 12, nucl 10, cyto 5, mito_nucl 5
Family & Domain DBs
KEGG cci:CC1G_02246  -  
Amino Acid Sequences MDSETDEQVPISSYELYIALHGDKDAEKRTPEKSQSLFMSLHGKKSKKNRRHRSRAYYRRDKSTWSLVLVDDNAFFTIYHIIATPFHGVNGTNETGRFVYDLEKIEGIQIGLMKDPSRYPKTRLLEYQIDIEPKLRLLQSIHVAEFPVHKIEEFENVLRRTFKAATVNPATSQAAVSQQWVPMVLSDLADAGFEGVLPWPRNEIARQFDLLLDTEGVIEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.11
6 0.09
7 0.09
8 0.09
9 0.1
10 0.12
11 0.16
12 0.19
13 0.22
14 0.24
15 0.28
16 0.33
17 0.4
18 0.43
19 0.47
20 0.45
21 0.48
22 0.47
23 0.47
24 0.42
25 0.35
26 0.4
27 0.34
28 0.39
29 0.4
30 0.4
31 0.42
32 0.53
33 0.62
34 0.62
35 0.72
36 0.76
37 0.8
38 0.89
39 0.93
40 0.93
41 0.94
42 0.94
43 0.94
44 0.93
45 0.87
46 0.85
47 0.75
48 0.69
49 0.63
50 0.61
51 0.52
52 0.43
53 0.39
54 0.31
55 0.31
56 0.27
57 0.22
58 0.13
59 0.11
60 0.1
61 0.08
62 0.08
63 0.07
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.09
71 0.11
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.13
78 0.12
79 0.1
80 0.11
81 0.12
82 0.11
83 0.11
84 0.1
85 0.07
86 0.08
87 0.11
88 0.12
89 0.12
90 0.12
91 0.12
92 0.12
93 0.12
94 0.09
95 0.07
96 0.06
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.08
103 0.14
104 0.19
105 0.21
106 0.25
107 0.33
108 0.37
109 0.4
110 0.41
111 0.41
112 0.4
113 0.39
114 0.38
115 0.32
116 0.29
117 0.25
118 0.23
119 0.17
120 0.13
121 0.14
122 0.1
123 0.09
124 0.1
125 0.13
126 0.17
127 0.19
128 0.19
129 0.18
130 0.18
131 0.18
132 0.18
133 0.16
134 0.12
135 0.1
136 0.1
137 0.11
138 0.11
139 0.16
140 0.16
141 0.18
142 0.23
143 0.24
144 0.25
145 0.25
146 0.25
147 0.25
148 0.23
149 0.25
150 0.26
151 0.27
152 0.33
153 0.36
154 0.37
155 0.33
156 0.35
157 0.32
158 0.24
159 0.23
160 0.16
161 0.15
162 0.14
163 0.16
164 0.14
165 0.14
166 0.14
167 0.15
168 0.14
169 0.1
170 0.13
171 0.11
172 0.1
173 0.09
174 0.09
175 0.09
176 0.08
177 0.08
178 0.05
179 0.04
180 0.04
181 0.04
182 0.06
183 0.12
184 0.14
185 0.14
186 0.17
187 0.18
188 0.21
189 0.25
190 0.29
191 0.3
192 0.32
193 0.34
194 0.32
195 0.32
196 0.31
197 0.28
198 0.23
199 0.17
200 0.14