Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VZZ0

Protein Details
Accession A0A316VZZ0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-87QVYRDCKKTWVEQRRKDRREGRPGAWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSAAPASVDGVPLGRQPEDHIKVMAGKTPSKFTDPCRRASALSMKCLEDNSYDKAKCAEAFQVYRDCKKTWVEQRRKDRREGRPGAWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.15
4 0.25
5 0.28
6 0.29
7 0.27
8 0.26
9 0.29
10 0.3
11 0.29
12 0.22
13 0.22
14 0.22
15 0.25
16 0.26
17 0.26
18 0.28
19 0.3
20 0.39
21 0.38
22 0.41
23 0.41
24 0.41
25 0.37
26 0.39
27 0.43
28 0.34
29 0.36
30 0.33
31 0.29
32 0.28
33 0.27
34 0.24
35 0.17
36 0.17
37 0.17
38 0.22
39 0.21
40 0.21
41 0.22
42 0.23
43 0.2
44 0.19
45 0.19
46 0.18
47 0.19
48 0.21
49 0.29
50 0.3
51 0.35
52 0.37
53 0.34
54 0.33
55 0.36
56 0.42
57 0.45
58 0.53
59 0.59
60 0.66
61 0.76
62 0.84
63 0.85
64 0.85
65 0.85
66 0.84
67 0.84
68 0.82