Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VYG3

Protein Details
Accession A0A316VYG3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-74VHVQRQKTLRERKKLWRETHPRRRSLBasic
NLS Segment(s)
PositionSequence
59-66ERKKLWRE
68-70HPR
Subcellular Location(s) mito 17.5, cyto_mito 11.5, cyto 4.5, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLKRAYQQSVLSGQLPVELVMADLRHRDAPASTRFTAGVFAVPAFLTGVHVQRQKTLRERKKLWRETHPRRRSLVWEDRAAPLLIKRDDGMALEKRVPPPLETIFRVHEPVAQLFPSARQHELEAIEHAQGRSKKIKQGLKVAGAVGIAGGGTALAYWAGTRLAYMPKSEMERYNQSQEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.14
4 0.11
5 0.08
6 0.07
7 0.08
8 0.08
9 0.08
10 0.09
11 0.11
12 0.12
13 0.12
14 0.13
15 0.14
16 0.2
17 0.25
18 0.31
19 0.29
20 0.29
21 0.29
22 0.28
23 0.28
24 0.22
25 0.17
26 0.1
27 0.1
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.08
35 0.1
36 0.15
37 0.18
38 0.18
39 0.24
40 0.28
41 0.31
42 0.4
43 0.49
44 0.53
45 0.59
46 0.66
47 0.71
48 0.78
49 0.82
50 0.79
51 0.79
52 0.81
53 0.82
54 0.87
55 0.84
56 0.78
57 0.71
58 0.68
59 0.63
60 0.61
61 0.59
62 0.52
63 0.47
64 0.44
65 0.42
66 0.41
67 0.35
68 0.26
69 0.18
70 0.18
71 0.15
72 0.14
73 0.13
74 0.12
75 0.12
76 0.12
77 0.15
78 0.12
79 0.13
80 0.15
81 0.17
82 0.17
83 0.2
84 0.2
85 0.17
86 0.18
87 0.21
88 0.22
89 0.22
90 0.24
91 0.23
92 0.23
93 0.24
94 0.2
95 0.18
96 0.17
97 0.16
98 0.15
99 0.13
100 0.12
101 0.11
102 0.14
103 0.17
104 0.17
105 0.17
106 0.16
107 0.17
108 0.2
109 0.21
110 0.19
111 0.17
112 0.16
113 0.16
114 0.16
115 0.16
116 0.18
117 0.19
118 0.22
119 0.28
120 0.3
121 0.35
122 0.42
123 0.48
124 0.48
125 0.56
126 0.58
127 0.54
128 0.53
129 0.47
130 0.39
131 0.33
132 0.27
133 0.17
134 0.1
135 0.05
136 0.04
137 0.03
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.03
145 0.04
146 0.04
147 0.04
148 0.05
149 0.08
150 0.14
151 0.15
152 0.17
153 0.18
154 0.22
155 0.27
156 0.31
157 0.33
158 0.34
159 0.42
160 0.46