Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VS65

Protein Details
Accession A0A316VS65   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-81NSRPVRHTHSRARRSKCRKNCKPSTLTRELSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12, nucl 4.5, cyto 2
Family & Domain DBs
Amino Acid Sequences MKFRRSRIMAWASLRPTRLRHDRRTFQGARRGLRPTPWPERGSLSVERGFNSRPVRHTHSRARRSKCRKNCKPSTLTRELSRRFGAVVAASVVAKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.4
4 0.42
5 0.49
6 0.51
7 0.57
8 0.63
9 0.69
10 0.73
11 0.79
12 0.76
13 0.72
14 0.72
15 0.67
16 0.61
17 0.57
18 0.54
19 0.46
20 0.44
21 0.44
22 0.42
23 0.44
24 0.47
25 0.43
26 0.4
27 0.43
28 0.41
29 0.39
30 0.34
31 0.29
32 0.27
33 0.26
34 0.25
35 0.23
36 0.21
37 0.22
38 0.24
39 0.23
40 0.22
41 0.27
42 0.34
43 0.39
44 0.46
45 0.51
46 0.57
47 0.65
48 0.71
49 0.74
50 0.77
51 0.81
52 0.85
53 0.86
54 0.87
55 0.87
56 0.89
57 0.91
58 0.9
59 0.88
60 0.87
61 0.86
62 0.83
63 0.77
64 0.74
65 0.73
66 0.67
67 0.64
68 0.56
69 0.47
70 0.39
71 0.34
72 0.29
73 0.2
74 0.18
75 0.13
76 0.12
77 0.12