Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316W6W8

Protein Details
Accession A0A316W6W8   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-37VSMKLLKSQARKARKRYYKPINYIDSQHydrophilic
NLS Segment(s)
PositionSequence
86-93KRAAKRIK
122-142KHRTLKRLEIKGRGRAGVRKH
Subcellular Location(s) mito 21.5, cyto_mito 11.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001063  Ribosomal_L22  
IPR036394  Ribosomal_L22/L17_sf  
IPR005727  Ribosomal_L22_bac/chlpt-type  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00237  Ribosomal_L22  
CDD cd00336  Ribosomal_L22  
Amino Acid Sequences MQKPEGVVPSVSMKLLKSQARKARKRYYKPINYIDSQGIVQRKETQHKYSTAAFKISNRKLKMLADQIGSGKPLDFAILQMQFSKKRAAKRIKSTLALAKDHAIAKGLDGKKLVVAEAWVNKHRTLKRLEIKGRGRAGVRKHKYCRLHIILREGLLQSEKDEKKLKEVRRQAYSIGTGGVSPTNAPLRNQWKSPGWQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.32
4 0.34
5 0.43
6 0.52
7 0.61
8 0.7
9 0.74
10 0.78
11 0.83
12 0.86
13 0.87
14 0.89
15 0.88
16 0.88
17 0.87
18 0.82
19 0.74
20 0.68
21 0.59
22 0.49
23 0.39
24 0.34
25 0.3
26 0.24
27 0.23
28 0.27
29 0.3
30 0.37
31 0.42
32 0.44
33 0.45
34 0.47
35 0.49
36 0.48
37 0.5
38 0.43
39 0.41
40 0.37
41 0.38
42 0.45
43 0.49
44 0.51
45 0.46
46 0.46
47 0.45
48 0.46
49 0.46
50 0.42
51 0.38
52 0.31
53 0.31
54 0.3
55 0.28
56 0.26
57 0.2
58 0.13
59 0.1
60 0.08
61 0.08
62 0.06
63 0.06
64 0.1
65 0.1
66 0.1
67 0.12
68 0.14
69 0.15
70 0.16
71 0.23
72 0.22
73 0.28
74 0.37
75 0.46
76 0.52
77 0.59
78 0.68
79 0.65
80 0.63
81 0.59
82 0.55
83 0.49
84 0.41
85 0.33
86 0.24
87 0.22
88 0.21
89 0.18
90 0.14
91 0.1
92 0.1
93 0.17
94 0.16
95 0.15
96 0.15
97 0.15
98 0.15
99 0.15
100 0.15
101 0.07
102 0.07
103 0.09
104 0.12
105 0.15
106 0.17
107 0.19
108 0.2
109 0.27
110 0.29
111 0.31
112 0.32
113 0.39
114 0.44
115 0.52
116 0.56
117 0.59
118 0.62
119 0.65
120 0.63
121 0.56
122 0.51
123 0.46
124 0.5
125 0.51
126 0.54
127 0.55
128 0.59
129 0.65
130 0.69
131 0.69
132 0.7
133 0.67
134 0.66
135 0.61
136 0.62
137 0.56
138 0.5
139 0.47
140 0.37
141 0.3
142 0.23
143 0.2
144 0.15
145 0.22
146 0.22
147 0.25
148 0.32
149 0.32
150 0.4
151 0.48
152 0.55
153 0.56
154 0.65
155 0.68
156 0.68
157 0.69
158 0.62
159 0.59
160 0.53
161 0.43
162 0.34
163 0.26
164 0.19
165 0.18
166 0.16
167 0.11
168 0.09
169 0.12
170 0.17
171 0.18
172 0.2
173 0.28
174 0.36
175 0.41
176 0.44
177 0.47
178 0.47