Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1CEN3

Protein Details
Accession A0A0D1CEN3    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
117-144ASNGTKSKPEPKPKKKPAKKRAVPEEDDBasic
NLS Segment(s)
PositionSequence
95-138RRKLARNAVPPNAKAANTKSTPASNGTKSKPEPKPKKKPAKKRA
Subcellular Location(s) nucl 20, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014876  DEK_C  
IPR019835  SWIB_domain  
IPR036885  SWIB_MDM2_dom_sf  
IPR003121  SWIB_MDM2_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0000500  C:RNA polymerase I upstream activating factor complex  
GO:0001165  F:RNA polymerase I cis-regulatory region sequence-specific DNA binding  
GO:0042790  P:nucleolar large rRNA transcription by RNA polymerase I  
GO:0006361  P:transcription initiation at RNA polymerase I promoter  
KEGG uma:UMAG_15039  -  
Pfam View protein in Pfam  
PF02201  SWIB  
PROSITE View protein in PROSITE  
PS51998  DEK_C  
PS51925  SWIB_MDM2  
CDD cd10567  SWIB-MDM2_like  
Amino Acid Sequences MSQPHALDPATVAILRPAIIQILNNADLSSISAKKVRAQLAQLPPHVLPPSLDLSASKKQVDEVIRDCFDHISKGLPAPPQSQHSYNGTASAPPRRKLARNAVPPNAKAANTKSTPASNGTKSKPEPKPKKKPAKKRAVPEEDDDNEPPKKRAANPNNPFNRPLILSPKLADVCGGTEMPRHAVVKQLWVYIKSNNLQNESNKRQILCDAKLTSIFGKESVDSFEMAKLIGSHLTKKDNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.09
5 0.09
6 0.09
7 0.1
8 0.11
9 0.15
10 0.16
11 0.16
12 0.15
13 0.14
14 0.13
15 0.15
16 0.16
17 0.13
18 0.14
19 0.17
20 0.18
21 0.23
22 0.3
23 0.33
24 0.32
25 0.36
26 0.43
27 0.49
28 0.55
29 0.51
30 0.47
31 0.42
32 0.42
33 0.39
34 0.3
35 0.21
36 0.18
37 0.2
38 0.17
39 0.17
40 0.15
41 0.19
42 0.25
43 0.27
44 0.25
45 0.21
46 0.21
47 0.27
48 0.29
49 0.28
50 0.26
51 0.29
52 0.3
53 0.3
54 0.3
55 0.26
56 0.23
57 0.19
58 0.16
59 0.13
60 0.13
61 0.14
62 0.16
63 0.17
64 0.19
65 0.21
66 0.24
67 0.26
68 0.29
69 0.29
70 0.29
71 0.29
72 0.31
73 0.27
74 0.27
75 0.22
76 0.21
77 0.21
78 0.27
79 0.29
80 0.27
81 0.31
82 0.33
83 0.36
84 0.41
85 0.5
86 0.5
87 0.55
88 0.6
89 0.62
90 0.62
91 0.58
92 0.56
93 0.47
94 0.38
95 0.3
96 0.27
97 0.25
98 0.23
99 0.24
100 0.21
101 0.2
102 0.2
103 0.22
104 0.23
105 0.21
106 0.25
107 0.26
108 0.3
109 0.31
110 0.39
111 0.43
112 0.5
113 0.57
114 0.63
115 0.73
116 0.78
117 0.88
118 0.88
119 0.92
120 0.92
121 0.92
122 0.88
123 0.87
124 0.87
125 0.83
126 0.77
127 0.69
128 0.65
129 0.56
130 0.52
131 0.43
132 0.35
133 0.3
134 0.28
135 0.26
136 0.21
137 0.22
138 0.25
139 0.35
140 0.42
141 0.51
142 0.57
143 0.66
144 0.71
145 0.7
146 0.65
147 0.55
148 0.47
149 0.37
150 0.33
151 0.3
152 0.26
153 0.25
154 0.24
155 0.28
156 0.26
157 0.24
158 0.21
159 0.15
160 0.13
161 0.13
162 0.13
163 0.08
164 0.1
165 0.11
166 0.13
167 0.15
168 0.14
169 0.13
170 0.19
171 0.2
172 0.25
173 0.26
174 0.29
175 0.28
176 0.3
177 0.32
178 0.28
179 0.33
180 0.29
181 0.33
182 0.32
183 0.34
184 0.36
185 0.42
186 0.49
187 0.5
188 0.54
189 0.52
190 0.48
191 0.46
192 0.49
193 0.48
194 0.42
195 0.43
196 0.37
197 0.36
198 0.36
199 0.37
200 0.32
201 0.27
202 0.25
203 0.18
204 0.18
205 0.17
206 0.17
207 0.19
208 0.18
209 0.16
210 0.16
211 0.17
212 0.15
213 0.14
214 0.14
215 0.1
216 0.1
217 0.15
218 0.16
219 0.2
220 0.25