Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RJS9

Protein Details
Accession D6RJS9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-54ELSKTHSKSHERRMKRKAKEQLASHydrophilic
NLS Segment(s)
PositionSequence
37-49SKSHERRMKRKAK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, mito_nucl 11.666, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG cci:CC1G_13662  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MSSPEDSSIGVSLTKKEKLALKREAFLQKLELSKTHSKSHERRMKRKAKEQLASGMTEIQAVLAALEEPQEPQGTESKAGESGETTTASGSSQTASSKSLKIGAGKSEPLSKAQRKKALQLERLRQPLILTNPSFSSNPFSTVRLHAQNTLLKKQPPPTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.26
4 0.32
5 0.38
6 0.46
7 0.51
8 0.5
9 0.51
10 0.57
11 0.61
12 0.55
13 0.48
14 0.43
15 0.37
16 0.36
17 0.35
18 0.29
19 0.29
20 0.35
21 0.38
22 0.41
23 0.43
24 0.49
25 0.54
26 0.64
27 0.67
28 0.68
29 0.74
30 0.78
31 0.83
32 0.82
33 0.85
34 0.84
35 0.84
36 0.79
37 0.72
38 0.69
39 0.61
40 0.53
41 0.43
42 0.34
43 0.24
44 0.19
45 0.16
46 0.08
47 0.06
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.1
61 0.1
62 0.11
63 0.11
64 0.11
65 0.12
66 0.12
67 0.11
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.06
74 0.07
75 0.07
76 0.07
77 0.05
78 0.05
79 0.05
80 0.06
81 0.07
82 0.09
83 0.11
84 0.12
85 0.12
86 0.15
87 0.16
88 0.18
89 0.19
90 0.2
91 0.21
92 0.22
93 0.22
94 0.24
95 0.23
96 0.25
97 0.31
98 0.35
99 0.42
100 0.48
101 0.56
102 0.53
103 0.6
104 0.65
105 0.67
106 0.68
107 0.68
108 0.69
109 0.68
110 0.71
111 0.63
112 0.54
113 0.46
114 0.43
115 0.4
116 0.38
117 0.31
118 0.28
119 0.29
120 0.32
121 0.31
122 0.26
123 0.27
124 0.21
125 0.25
126 0.24
127 0.24
128 0.25
129 0.29
130 0.35
131 0.34
132 0.36
133 0.35
134 0.38
135 0.42
136 0.45
137 0.47
138 0.47
139 0.44
140 0.48