Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VWI8

Protein Details
Accession A0A316VWI8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
382-411AQVKLRRKKGGAFRRKPKKKATADEGRKETBasic
NLS Segment(s)
PositionSequence
385-403KLRRKKGGAFRRKPKKKAT
Subcellular Location(s) nucl 11.5, cyto_nucl 10.833, cyto 9, cyto_mito 6.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020796  ORC5  
IPR047088  ORC5_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0000808  C:origin recognition complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF14630  ORC5_C  
Amino Acid Sequences MAELTAHWPGHGTVIRTLLDFFGDPGSPVPPAVHIHASSAARADALIASLFERTSVTSCKIDPLQVCSVSSVFERLVADLGGASSSRPKAHFDNLDLALNGLARALSHEWERKTVIVVKGAERMRDVWDEALSDAFWRLAELLGLQGRLCVVTISTLSIRHFRTVKGNAPSLGSGQPLQLRMSALHKLDALQLLRKDADQLVNGISSTPAQLSGLRALHEVYIGLAYDTLSADVVDEEEMRMIVAAIWHPFVVPVQTGEVTSTALPALLARSAPLFRDALLRVLPRLVWPQAWVRWAVAQARERSEAAVAGNERSAARTTAQRGSQAKRSSGTSMESASLARLETYIIIAAFLASFNPARLDMRYFLRDEHALLPAAERAEAQVKLRRKKGGAFRRKPKKKATADEGRKETLNSQALLGPKPFPVERLLAILQALLIESKEDTALLQDSDRVGGPSAAQQAEVLSRSSDVFKQINRLVTQRFLTRFSSSSAVLAPNVQLRCNVTHEHVLRLCKAVSFDLQEWLWDWAGGAGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.26
4 0.27
5 0.21
6 0.19
7 0.17
8 0.14
9 0.13
10 0.12
11 0.12
12 0.13
13 0.14
14 0.12
15 0.12
16 0.12
17 0.12
18 0.15
19 0.18
20 0.22
21 0.21
22 0.23
23 0.28
24 0.29
25 0.26
26 0.25
27 0.21
28 0.16
29 0.16
30 0.14
31 0.08
32 0.09
33 0.08
34 0.07
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.11
42 0.15
43 0.18
44 0.2
45 0.21
46 0.26
47 0.27
48 0.31
49 0.3
50 0.33
51 0.35
52 0.34
53 0.34
54 0.3
55 0.29
56 0.25
57 0.23
58 0.19
59 0.13
60 0.14
61 0.14
62 0.13
63 0.13
64 0.12
65 0.11
66 0.09
67 0.09
68 0.07
69 0.06
70 0.06
71 0.1
72 0.12
73 0.15
74 0.16
75 0.21
76 0.24
77 0.33
78 0.37
79 0.36
80 0.41
81 0.4
82 0.41
83 0.37
84 0.33
85 0.25
86 0.2
87 0.16
88 0.09
89 0.07
90 0.05
91 0.08
92 0.09
93 0.1
94 0.15
95 0.21
96 0.23
97 0.26
98 0.27
99 0.25
100 0.27
101 0.32
102 0.3
103 0.3
104 0.31
105 0.3
106 0.36
107 0.37
108 0.34
109 0.29
110 0.28
111 0.25
112 0.25
113 0.24
114 0.18
115 0.17
116 0.17
117 0.16
118 0.15
119 0.11
120 0.09
121 0.09
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.08
130 0.09
131 0.09
132 0.09
133 0.08
134 0.08
135 0.08
136 0.08
137 0.05
138 0.04
139 0.05
140 0.06
141 0.07
142 0.08
143 0.1
144 0.12
145 0.17
146 0.18
147 0.21
148 0.23
149 0.22
150 0.3
151 0.33
152 0.39
153 0.39
154 0.4
155 0.37
156 0.37
157 0.36
158 0.3
159 0.25
160 0.19
161 0.15
162 0.14
163 0.15
164 0.15
165 0.15
166 0.14
167 0.14
168 0.14
169 0.16
170 0.18
171 0.17
172 0.17
173 0.16
174 0.16
175 0.17
176 0.19
177 0.17
178 0.17
179 0.17
180 0.18
181 0.18
182 0.17
183 0.17
184 0.15
185 0.17
186 0.13
187 0.13
188 0.12
189 0.12
190 0.12
191 0.1
192 0.09
193 0.07
194 0.07
195 0.06
196 0.05
197 0.05
198 0.06
199 0.07
200 0.11
201 0.12
202 0.12
203 0.12
204 0.12
205 0.12
206 0.11
207 0.1
208 0.06
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.04
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.06
249 0.06
250 0.05
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.06
261 0.07
262 0.07
263 0.07
264 0.11
265 0.11
266 0.12
267 0.13
268 0.13
269 0.12
270 0.12
271 0.12
272 0.1
273 0.12
274 0.12
275 0.1
276 0.12
277 0.15
278 0.17
279 0.18
280 0.17
281 0.14
282 0.15
283 0.17
284 0.17
285 0.19
286 0.21
287 0.23
288 0.25
289 0.26
290 0.25
291 0.23
292 0.21
293 0.17
294 0.12
295 0.13
296 0.11
297 0.09
298 0.09
299 0.1
300 0.09
301 0.1
302 0.1
303 0.08
304 0.09
305 0.13
306 0.16
307 0.2
308 0.22
309 0.27
310 0.31
311 0.33
312 0.4
313 0.39
314 0.38
315 0.35
316 0.35
317 0.31
318 0.28
319 0.27
320 0.21
321 0.18
322 0.17
323 0.15
324 0.13
325 0.12
326 0.1
327 0.08
328 0.07
329 0.06
330 0.05
331 0.05
332 0.05
333 0.06
334 0.05
335 0.05
336 0.05
337 0.05
338 0.04
339 0.04
340 0.04
341 0.04
342 0.05
343 0.05
344 0.06
345 0.07
346 0.08
347 0.09
348 0.12
349 0.14
350 0.18
351 0.2
352 0.2
353 0.21
354 0.22
355 0.22
356 0.21
357 0.21
358 0.18
359 0.16
360 0.16
361 0.15
362 0.14
363 0.14
364 0.11
365 0.09
366 0.09
367 0.12
368 0.13
369 0.15
370 0.2
371 0.28
372 0.35
373 0.41
374 0.45
375 0.43
376 0.5
377 0.58
378 0.62
379 0.66
380 0.69
381 0.75
382 0.81
383 0.88
384 0.88
385 0.88
386 0.87
387 0.86
388 0.85
389 0.84
390 0.84
391 0.84
392 0.85
393 0.8
394 0.71
395 0.62
396 0.54
397 0.45
398 0.42
399 0.35
400 0.27
401 0.23
402 0.24
403 0.25
404 0.26
405 0.26
406 0.2
407 0.17
408 0.2
409 0.19
410 0.18
411 0.18
412 0.19
413 0.18
414 0.22
415 0.22
416 0.19
417 0.19
418 0.17
419 0.14
420 0.11
421 0.1
422 0.05
423 0.05
424 0.05
425 0.05
426 0.05
427 0.06
428 0.06
429 0.05
430 0.07
431 0.09
432 0.09
433 0.09
434 0.1
435 0.11
436 0.12
437 0.13
438 0.11
439 0.11
440 0.11
441 0.11
442 0.14
443 0.18
444 0.17
445 0.17
446 0.16
447 0.16
448 0.18
449 0.18
450 0.15
451 0.1
452 0.11
453 0.12
454 0.15
455 0.16
456 0.19
457 0.22
458 0.23
459 0.31
460 0.34
461 0.39
462 0.39
463 0.42
464 0.4
465 0.42
466 0.44
467 0.43
468 0.41
469 0.39
470 0.4
471 0.38
472 0.36
473 0.34
474 0.34
475 0.27
476 0.26
477 0.25
478 0.22
479 0.19
480 0.19
481 0.18
482 0.21
483 0.22
484 0.21
485 0.21
486 0.23
487 0.25
488 0.28
489 0.29
490 0.27
491 0.35
492 0.36
493 0.42
494 0.43
495 0.45
496 0.43
497 0.43
498 0.39
499 0.32
500 0.32
501 0.27
502 0.27
503 0.29
504 0.28
505 0.3
506 0.29
507 0.28
508 0.27
509 0.27
510 0.23
511 0.17
512 0.15
513 0.12