Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VUK1

Protein Details
Accession A0A316VUK1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MAATKIPIVKKRTKSFKRHHSDRYKRVGTSHydrophilic
NLS Segment(s)
PositionSequence
10-47KKRTKSFKRHHSDRYKRVGTSHRHQRGIDSATRRRFRG
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATKIPIVKKRTKSFKRHHSDRYKRVGTSHRHQRGIDSATRRRFRGTAPQPKIGYGSNKKTRHLLPNGYRRFLVHNPRDVDLLLMHNASFAAEIAHNVSSRKRLDILEKAKILGVKVTNAGAKVRSEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.88
4 0.89
5 0.89
6 0.9
7 0.9
8 0.91
9 0.9
10 0.89
11 0.84
12 0.74
13 0.71
14 0.69
15 0.66
16 0.65
17 0.67
18 0.64
19 0.63
20 0.62
21 0.59
22 0.56
23 0.53
24 0.49
25 0.46
26 0.45
27 0.5
28 0.54
29 0.51
30 0.48
31 0.44
32 0.41
33 0.44
34 0.47
35 0.48
36 0.5
37 0.57
38 0.54
39 0.53
40 0.52
41 0.43
42 0.41
43 0.37
44 0.41
45 0.43
46 0.45
47 0.46
48 0.48
49 0.5
50 0.49
51 0.48
52 0.47
53 0.46
54 0.54
55 0.56
56 0.53
57 0.49
58 0.42
59 0.42
60 0.4
61 0.41
62 0.36
63 0.4
64 0.4
65 0.41
66 0.41
67 0.35
68 0.3
69 0.21
70 0.18
71 0.12
72 0.1
73 0.09
74 0.08
75 0.08
76 0.07
77 0.06
78 0.04
79 0.05
80 0.05
81 0.05
82 0.07
83 0.09
84 0.09
85 0.1
86 0.12
87 0.17
88 0.18
89 0.2
90 0.21
91 0.22
92 0.29
93 0.38
94 0.43
95 0.45
96 0.45
97 0.43
98 0.42
99 0.41
100 0.35
101 0.3
102 0.25
103 0.19
104 0.2
105 0.21
106 0.21
107 0.21
108 0.23
109 0.2
110 0.2