Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VTV8

Protein Details
Accession A0A316VTV8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-71CSCCCCCWRLSRLRRRRARRQRIAYTRAHydrophilic
NLS Segment(s)
PositionSequence
55-65RLRRRRARRQR
Subcellular Location(s) mito 11, extr 5, nucl 3, cyto 3, plas 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MRRRGGQAGRRAGGGDGSSGSYIYISSSRAVFRIADCCSCCCCCSCCCCCWRLSRLRRRRARRQRIAYTRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.19
3 0.11
4 0.11
5 0.1
6 0.09
7 0.09
8 0.07
9 0.06
10 0.06
11 0.07
12 0.07
13 0.07
14 0.09
15 0.09
16 0.09
17 0.1
18 0.1
19 0.1
20 0.13
21 0.14
22 0.15
23 0.15
24 0.17
25 0.18
26 0.19
27 0.19
28 0.16
29 0.17
30 0.17
31 0.22
32 0.24
33 0.26
34 0.28
35 0.29
36 0.31
37 0.36
38 0.42
39 0.46
40 0.53
41 0.6
42 0.68
43 0.76
44 0.83
45 0.87
46 0.9
47 0.91
48 0.92
49 0.92
50 0.92
51 0.92