Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VYF7

Protein Details
Accession A0A316VYF7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-80APCGWHPQRRRHVLKTCLPNMRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MKKLHNPSSKVLLVWWFLNQYRSLPSPYGGALLYYTFAYCAQMLPRMDASEAAVPRHTAPCGWHPQRRRHVLKTCLPNMRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.2
4 0.2
5 0.22
6 0.2
7 0.18
8 0.2
9 0.21
10 0.22
11 0.19
12 0.19
13 0.18
14 0.17
15 0.17
16 0.13
17 0.11
18 0.09
19 0.08
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.11
30 0.11
31 0.12
32 0.12
33 0.12
34 0.12
35 0.12
36 0.13
37 0.13
38 0.13
39 0.13
40 0.13
41 0.13
42 0.14
43 0.16
44 0.15
45 0.11
46 0.14
47 0.2
48 0.3
49 0.36
50 0.42
51 0.48
52 0.58
53 0.68
54 0.75
55 0.76
56 0.76
57 0.79
58 0.8
59 0.82
60 0.82
61 0.8
62 0.78