Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316WFJ7

Protein Details
Accession A0A316WFJ7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-35LAAATKTAKKKKWSKGKVKDKAQNMVVHydrophilic
NLS Segment(s)
PositionSequence
13-28TKTAKKKKWSKGKVKD
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKSAILAAATKTAKKKKWSKGKVKDKAQNMVVLDRPTYDKILKEVPTFKMISQSTLIDRMKINGSLARVAIQHLVREGQIKKVIHHRGQLVYTRVGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.44
4 0.51
5 0.59
6 0.62
7 0.72
8 0.79
9 0.83
10 0.86
11 0.91
12 0.91
13 0.92
14 0.89
15 0.84
16 0.8
17 0.71
18 0.64
19 0.54
20 0.46
21 0.39
22 0.32
23 0.26
24 0.2
25 0.2
26 0.17
27 0.18
28 0.17
29 0.14
30 0.15
31 0.2
32 0.21
33 0.21
34 0.24
35 0.23
36 0.25
37 0.25
38 0.23
39 0.25
40 0.23
41 0.22
42 0.2
43 0.19
44 0.17
45 0.23
46 0.23
47 0.17
48 0.17
49 0.18
50 0.18
51 0.17
52 0.18
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.12
59 0.12
60 0.16
61 0.14
62 0.14
63 0.14
64 0.14
65 0.14
66 0.19
67 0.2
68 0.21
69 0.27
70 0.27
71 0.3
72 0.39
73 0.47
74 0.46
75 0.51
76 0.5
77 0.48
78 0.52
79 0.55
80 0.49
81 0.44