Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316W1Q2

Protein Details
Accession A0A316W1Q2    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-58VLSRRASRPSRPPRPLPLSARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001834  CBR-like  
IPR039261  FNR_nucleotide-bd  
IPR001433  OxRdtase_FAD/NAD-bd  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00175  NAD_binding_1  
CDD cd06183  cyt_b5_reduct_like  
Amino Acid Sequences MQMLRPRLLRSCQALPRGEGCARCIRDRSTAAPSAPTVLSRRASRPSRPPRPLPLSARHASTSTAGRRSTASNGSARGKILYLLVGAGIASAAVYSKTSQPLRAQRRNIIAPDTFQEFRVTQKRIASSTLLEEKGDGEHVMLDVDVEVSLNEDQQGGQSGKEAMCIHTLHLASPALSIQRPYTPLYSPFVVSNDAPASIKTPKSALRKVQLMIKKYNDGEVGRFAHSLASGDQILLRGFDKSWQGDGTETELILIAGGTGITPMHQLISSLFGSNASSNSAATATTTKPKITLLYSAHQISALCLLPELEDLRQRAGAERLHIELFVDQHSHSHSLYERVFGRRTKEVRGMKLNGNRVGLKDLERIAKQKDAHTHCKVLIAGPDGMVEAIAGPKARDGKSQGELGGHLSHLGWKKEQVWKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.53
4 0.52
5 0.5
6 0.42
7 0.4
8 0.42
9 0.42
10 0.43
11 0.45
12 0.42
13 0.46
14 0.48
15 0.49
16 0.47
17 0.49
18 0.45
19 0.43
20 0.4
21 0.36
22 0.33
23 0.31
24 0.26
25 0.26
26 0.3
27 0.32
28 0.36
29 0.41
30 0.47
31 0.53
32 0.6
33 0.66
34 0.72
35 0.76
36 0.79
37 0.8
38 0.82
39 0.82
40 0.79
41 0.76
42 0.74
43 0.68
44 0.64
45 0.55
46 0.48
47 0.41
48 0.36
49 0.35
50 0.33
51 0.36
52 0.32
53 0.32
54 0.33
55 0.34
56 0.36
57 0.33
58 0.31
59 0.29
60 0.34
61 0.37
62 0.37
63 0.35
64 0.3
65 0.25
66 0.22
67 0.19
68 0.15
69 0.11
70 0.09
71 0.08
72 0.07
73 0.06
74 0.05
75 0.04
76 0.03
77 0.02
78 0.02
79 0.03
80 0.03
81 0.04
82 0.05
83 0.09
84 0.15
85 0.17
86 0.21
87 0.29
88 0.39
89 0.49
90 0.56
91 0.59
92 0.6
93 0.65
94 0.66
95 0.61
96 0.56
97 0.46
98 0.39
99 0.36
100 0.34
101 0.28
102 0.24
103 0.24
104 0.19
105 0.25
106 0.31
107 0.31
108 0.3
109 0.34
110 0.36
111 0.35
112 0.37
113 0.32
114 0.26
115 0.28
116 0.3
117 0.26
118 0.23
119 0.22
120 0.2
121 0.18
122 0.17
123 0.12
124 0.07
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.03
134 0.03
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.06
142 0.09
143 0.08
144 0.08
145 0.09
146 0.11
147 0.11
148 0.14
149 0.14
150 0.12
151 0.14
152 0.15
153 0.14
154 0.17
155 0.17
156 0.14
157 0.15
158 0.14
159 0.11
160 0.11
161 0.11
162 0.08
163 0.09
164 0.09
165 0.08
166 0.1
167 0.12
168 0.13
169 0.15
170 0.15
171 0.17
172 0.19
173 0.19
174 0.18
175 0.17
176 0.16
177 0.16
178 0.14
179 0.14
180 0.11
181 0.11
182 0.1
183 0.09
184 0.11
185 0.12
186 0.13
187 0.11
188 0.13
189 0.19
190 0.25
191 0.3
192 0.33
193 0.35
194 0.37
195 0.38
196 0.43
197 0.41
198 0.38
199 0.38
200 0.35
201 0.34
202 0.3
203 0.31
204 0.27
205 0.23
206 0.2
207 0.2
208 0.2
209 0.17
210 0.17
211 0.15
212 0.13
213 0.12
214 0.12
215 0.08
216 0.08
217 0.07
218 0.07
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.06
225 0.06
226 0.09
227 0.11
228 0.11
229 0.13
230 0.12
231 0.13
232 0.13
233 0.13
234 0.14
235 0.12
236 0.11
237 0.1
238 0.09
239 0.09
240 0.08
241 0.07
242 0.03
243 0.02
244 0.02
245 0.02
246 0.02
247 0.02
248 0.03
249 0.03
250 0.03
251 0.04
252 0.04
253 0.05
254 0.05
255 0.09
256 0.09
257 0.09
258 0.09
259 0.09
260 0.1
261 0.1
262 0.1
263 0.08
264 0.08
265 0.07
266 0.08
267 0.08
268 0.07
269 0.07
270 0.1
271 0.1
272 0.15
273 0.17
274 0.16
275 0.17
276 0.18
277 0.2
278 0.19
279 0.24
280 0.22
281 0.24
282 0.28
283 0.28
284 0.27
285 0.26
286 0.24
287 0.18
288 0.17
289 0.14
290 0.1
291 0.09
292 0.09
293 0.08
294 0.1
295 0.11
296 0.09
297 0.13
298 0.14
299 0.15
300 0.16
301 0.16
302 0.18
303 0.21
304 0.21
305 0.2
306 0.21
307 0.22
308 0.21
309 0.21
310 0.19
311 0.16
312 0.15
313 0.13
314 0.13
315 0.1
316 0.11
317 0.14
318 0.16
319 0.14
320 0.16
321 0.16
322 0.21
323 0.22
324 0.25
325 0.26
326 0.29
327 0.34
328 0.34
329 0.38
330 0.41
331 0.43
332 0.45
333 0.51
334 0.53
335 0.57
336 0.62
337 0.62
338 0.61
339 0.65
340 0.66
341 0.61
342 0.57
343 0.51
344 0.44
345 0.42
346 0.36
347 0.32
348 0.29
349 0.29
350 0.31
351 0.32
352 0.35
353 0.35
354 0.39
355 0.39
356 0.41
357 0.47
358 0.49
359 0.56
360 0.58
361 0.59
362 0.53
363 0.55
364 0.49
365 0.42
366 0.38
367 0.33
368 0.27
369 0.23
370 0.22
371 0.18
372 0.17
373 0.14
374 0.09
375 0.06
376 0.06
377 0.07
378 0.07
379 0.07
380 0.11
381 0.18
382 0.19
383 0.24
384 0.28
385 0.33
386 0.37
387 0.41
388 0.39
389 0.34
390 0.33
391 0.31
392 0.28
393 0.21
394 0.18
395 0.15
396 0.19
397 0.24
398 0.26
399 0.26
400 0.29
401 0.35