Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N028

Protein Details
Accession A8N028    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
50-74SRGSSRCSTKCSRKSRRAMVNGSFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
KEGG cci:CC1G_02798  -  
Amino Acid Sequences MSTSRPFPPELVSETNAIVAISRRFGTRLDLTIRMQRYYEPNSGRPMSTSRGSSRCSTKCSRKSRRAMVNGSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.22
4 0.18
5 0.13
6 0.1
7 0.1
8 0.1
9 0.11
10 0.11
11 0.11
12 0.12
13 0.17
14 0.17
15 0.19
16 0.21
17 0.23
18 0.25
19 0.29
20 0.3
21 0.26
22 0.24
23 0.22
24 0.23
25 0.25
26 0.29
27 0.27
28 0.28
29 0.32
30 0.33
31 0.32
32 0.29
33 0.27
34 0.25
35 0.24
36 0.26
37 0.26
38 0.29
39 0.32
40 0.34
41 0.4
42 0.4
43 0.44
44 0.49
45 0.55
46 0.6
47 0.69
48 0.75
49 0.77
50 0.83
51 0.87
52 0.89
53 0.87
54 0.86