Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RL81

Protein Details
Accession D6RL81    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
219-242LDPYHRGRSRSRHRSRSRPRSYSABasic
375-401VPPQTIVIHKSRRHKHRHRSRSRAGSEBasic
NLS Segment(s)
PositionSequence
225-237GRSRSRHRSRSRP
384-399KSRRHKHRHRSRSRAG
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
KEGG cci:CC1G_14216  -  
Amino Acid Sequences MAYVQYSQPIGQPAWGAGQMPGYPGALAAPAFQPQPTWGGLDFYRAHAPSNYNDPSLFNHAWDRVRQFDAATAGGLGVGIHEAKHWHRRAYGGMPELAHLGPAEVGHAAAYEAYRNWVRNQSMYDTLGPDIERQREGLIGLAVAEAGRLLSFAGRSMDHYARSAASDAAAHTASYIFYQRRRDDEYYHHRGRSRSRGRYDPEWDELDEPYRYEDDHETLDPYHRGRSRSRHRSRSRPRSYSAHAHMPYEGTPYPGTPGGFPPLGGAPSYAGSHGGGPLPPLGVPYASSGGGIPPPPPLTSGGYSSGYSTSGYYPPPNSGYGPQGGYGSYGGAYPAPGMPMAVPLGHAASNSSGYSYGSQPYSTTGSVVGAPTAGVPPQTIVIHKSRRHKHRHRSRSRAGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.14
5 0.16
6 0.15
7 0.15
8 0.15
9 0.13
10 0.12
11 0.11
12 0.1
13 0.09
14 0.09
15 0.09
16 0.09
17 0.11
18 0.12
19 0.12
20 0.12
21 0.12
22 0.15
23 0.14
24 0.15
25 0.14
26 0.17
27 0.17
28 0.23
29 0.23
30 0.23
31 0.28
32 0.26
33 0.28
34 0.27
35 0.3
36 0.27
37 0.35
38 0.34
39 0.3
40 0.3
41 0.29
42 0.3
43 0.35
44 0.33
45 0.26
46 0.27
47 0.31
48 0.33
49 0.37
50 0.36
51 0.33
52 0.35
53 0.33
54 0.29
55 0.28
56 0.27
57 0.23
58 0.19
59 0.14
60 0.12
61 0.11
62 0.1
63 0.06
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.08
70 0.13
71 0.23
72 0.26
73 0.29
74 0.3
75 0.33
76 0.37
77 0.41
78 0.43
79 0.37
80 0.36
81 0.32
82 0.31
83 0.31
84 0.25
85 0.19
86 0.12
87 0.09
88 0.07
89 0.07
90 0.07
91 0.05
92 0.05
93 0.04
94 0.05
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.09
101 0.11
102 0.13
103 0.16
104 0.22
105 0.23
106 0.25
107 0.28
108 0.28
109 0.3
110 0.31
111 0.29
112 0.24
113 0.22
114 0.21
115 0.18
116 0.18
117 0.18
118 0.18
119 0.17
120 0.16
121 0.17
122 0.16
123 0.15
124 0.13
125 0.09
126 0.07
127 0.07
128 0.06
129 0.05
130 0.04
131 0.04
132 0.03
133 0.03
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.04
140 0.06
141 0.06
142 0.08
143 0.13
144 0.15
145 0.15
146 0.16
147 0.16
148 0.15
149 0.16
150 0.15
151 0.1
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.07
158 0.06
159 0.07
160 0.06
161 0.07
162 0.1
163 0.1
164 0.14
165 0.21
166 0.23
167 0.26
168 0.33
169 0.34
170 0.35
171 0.42
172 0.47
173 0.5
174 0.52
175 0.51
176 0.48
177 0.49
178 0.52
179 0.53
180 0.54
181 0.53
182 0.54
183 0.58
184 0.59
185 0.62
186 0.62
187 0.54
188 0.48
189 0.41
190 0.37
191 0.31
192 0.26
193 0.22
194 0.17
195 0.13
196 0.11
197 0.1
198 0.09
199 0.1
200 0.11
201 0.1
202 0.12
203 0.12
204 0.12
205 0.12
206 0.14
207 0.14
208 0.14
209 0.18
210 0.2
211 0.22
212 0.26
213 0.36
214 0.45
215 0.55
216 0.64
217 0.69
218 0.74
219 0.82
220 0.88
221 0.89
222 0.88
223 0.83
224 0.78
225 0.74
226 0.72
227 0.69
228 0.63
229 0.61
230 0.51
231 0.46
232 0.42
233 0.36
234 0.31
235 0.26
236 0.21
237 0.14
238 0.13
239 0.12
240 0.14
241 0.14
242 0.14
243 0.11
244 0.13
245 0.14
246 0.14
247 0.14
248 0.13
249 0.12
250 0.12
251 0.11
252 0.1
253 0.07
254 0.09
255 0.09
256 0.08
257 0.08
258 0.07
259 0.08
260 0.08
261 0.08
262 0.07
263 0.08
264 0.08
265 0.08
266 0.07
267 0.08
268 0.07
269 0.06
270 0.07
271 0.08
272 0.1
273 0.09
274 0.1
275 0.09
276 0.1
277 0.11
278 0.11
279 0.09
280 0.11
281 0.12
282 0.12
283 0.13
284 0.15
285 0.17
286 0.19
287 0.21
288 0.21
289 0.22
290 0.22
291 0.22
292 0.2
293 0.16
294 0.15
295 0.14
296 0.13
297 0.13
298 0.15
299 0.17
300 0.18
301 0.2
302 0.22
303 0.23
304 0.22
305 0.23
306 0.24
307 0.24
308 0.24
309 0.22
310 0.2
311 0.18
312 0.17
313 0.14
314 0.11
315 0.08
316 0.07
317 0.07
318 0.07
319 0.07
320 0.07
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.08
327 0.09
328 0.08
329 0.08
330 0.08
331 0.1
332 0.09
333 0.09
334 0.09
335 0.1
336 0.12
337 0.11
338 0.11
339 0.1
340 0.11
341 0.14
342 0.14
343 0.17
344 0.16
345 0.16
346 0.16
347 0.19
348 0.22
349 0.2
350 0.18
351 0.15
352 0.15
353 0.16
354 0.16
355 0.13
356 0.09
357 0.09
358 0.09
359 0.09
360 0.09
361 0.08
362 0.08
363 0.09
364 0.12
365 0.13
366 0.14
367 0.18
368 0.26
369 0.35
370 0.41
371 0.51
372 0.58
373 0.67
374 0.77
375 0.83
376 0.86
377 0.88
378 0.93
379 0.94
380 0.94
381 0.95