Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VXJ3

Protein Details
Accession A0A316VXJ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
150-175LHKECWRSSCRWWRAKKKSDKVFYGVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7, plas 6, extr 5, cyto_nucl 5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLEPLSTFSTFSTFLLLDTTPCMYPFTMQPAVLLLWMLALPRSQSAPLKATFAAHVEGSRKDAVDVSRGLVSHSSLAFSKTQLHVLTFLRLLSPCLERVRRVRQKVQASSLELTSAIPFAELYESASEHLSPTSAANLTPGSSFNPRRLHKECWRSSCRWWRAKKKSDKVFYGVATGVGGLTVVASSVAVGACSVSRAKSVRHCPDAPPSVAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.14
5 0.12
6 0.13
7 0.15
8 0.12
9 0.13
10 0.14
11 0.12
12 0.14
13 0.15
14 0.21
15 0.22
16 0.21
17 0.21
18 0.21
19 0.21
20 0.19
21 0.17
22 0.09
23 0.06
24 0.07
25 0.06
26 0.05
27 0.05
28 0.06
29 0.07
30 0.09
31 0.11
32 0.14
33 0.17
34 0.2
35 0.21
36 0.23
37 0.22
38 0.22
39 0.2
40 0.19
41 0.17
42 0.14
43 0.14
44 0.14
45 0.15
46 0.17
47 0.16
48 0.15
49 0.14
50 0.16
51 0.15
52 0.16
53 0.16
54 0.14
55 0.15
56 0.15
57 0.15
58 0.13
59 0.13
60 0.11
61 0.11
62 0.1
63 0.09
64 0.11
65 0.11
66 0.11
67 0.14
68 0.13
69 0.16
70 0.15
71 0.16
72 0.17
73 0.17
74 0.18
75 0.15
76 0.14
77 0.12
78 0.11
79 0.12
80 0.11
81 0.11
82 0.12
83 0.16
84 0.17
85 0.19
86 0.26
87 0.36
88 0.42
89 0.46
90 0.51
91 0.54
92 0.61
93 0.61
94 0.6
95 0.53
96 0.47
97 0.43
98 0.36
99 0.28
100 0.2
101 0.16
102 0.11
103 0.08
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.08
126 0.08
127 0.08
128 0.09
129 0.1
130 0.16
131 0.18
132 0.24
133 0.33
134 0.34
135 0.42
136 0.46
137 0.52
138 0.55
139 0.64
140 0.66
141 0.66
142 0.71
143 0.67
144 0.72
145 0.74
146 0.74
147 0.73
148 0.75
149 0.77
150 0.81
151 0.87
152 0.89
153 0.88
154 0.89
155 0.88
156 0.83
157 0.76
158 0.7
159 0.61
160 0.53
161 0.42
162 0.32
163 0.23
164 0.18
165 0.13
166 0.08
167 0.07
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.07
182 0.08
183 0.08
184 0.12
185 0.15
186 0.2
187 0.29
188 0.4
189 0.48
190 0.55
191 0.56
192 0.56
193 0.64
194 0.66