Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316W5L8

Protein Details
Accession A0A316W5L8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
210-231RNTSLNPKHKPKPKLKPKSEVDBasic
326-353QESPFSRAELRRKRRVREHRRRGGACSDBasic
NLS Segment(s)
PositionSequence
217-227KHKPKPKLKPK
335-348LRRKRRVREHRRRG
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Amino Acid Sequences MTAFAKLSHTQPSCIDSAPVLRTGPSLTNESPISSHAAQMISSRRINKVLQLATAEAARSGLRRRHGAVILKGGKVLSSGHNLTRPRFSGDAPTNTSNSVSELGKSQNAMAFSMHAEMSAISNALGGARPPAVKLGSAPLTLRFQRTFAVLADTVSTSAHAQSLVPQEDAELLKLKSLARKEQMKCQKSFGSGSSASSDAEASDAQQDIRNTSLNPKHKPKPKLKPKSEVDGQEPTRSSEATQAVDAVQSRSCTAVDPQDSVSLRDHIEMQDCCAGAAAHEPSHSPGPTPRHSASPAAQIPNAAFATGSAPSTRLRGADIYVVRLQESPFSRAELRRKRRVREHRRRGGACSDAAETVNTRFVGSAHINEDQACVDSDYADSRPCWRCIQWCRWAGIKRAFWTTKDGRWEGAKISDLVAGSSSFHITRAEMQSQLWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.22
4 0.26
5 0.25
6 0.25
7 0.22
8 0.2
9 0.2
10 0.22
11 0.24
12 0.22
13 0.26
14 0.24
15 0.28
16 0.28
17 0.28
18 0.26
19 0.23
20 0.27
21 0.21
22 0.22
23 0.2
24 0.2
25 0.19
26 0.23
27 0.28
28 0.28
29 0.32
30 0.34
31 0.34
32 0.38
33 0.39
34 0.4
35 0.42
36 0.38
37 0.36
38 0.35
39 0.33
40 0.3
41 0.3
42 0.24
43 0.15
44 0.14
45 0.12
46 0.12
47 0.18
48 0.22
49 0.26
50 0.3
51 0.33
52 0.39
53 0.45
54 0.5
55 0.48
56 0.53
57 0.52
58 0.48
59 0.46
60 0.39
61 0.33
62 0.26
63 0.23
64 0.16
65 0.18
66 0.2
67 0.22
68 0.28
69 0.31
70 0.33
71 0.37
72 0.36
73 0.34
74 0.33
75 0.32
76 0.35
77 0.4
78 0.43
79 0.43
80 0.44
81 0.4
82 0.39
83 0.38
84 0.29
85 0.24
86 0.2
87 0.15
88 0.13
89 0.14
90 0.16
91 0.17
92 0.17
93 0.16
94 0.15
95 0.15
96 0.15
97 0.13
98 0.12
99 0.11
100 0.12
101 0.11
102 0.09
103 0.08
104 0.07
105 0.08
106 0.07
107 0.07
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.06
115 0.07
116 0.08
117 0.08
118 0.1
119 0.1
120 0.1
121 0.11
122 0.14
123 0.15
124 0.16
125 0.16
126 0.17
127 0.21
128 0.22
129 0.25
130 0.21
131 0.19
132 0.19
133 0.2
134 0.19
135 0.15
136 0.18
137 0.14
138 0.14
139 0.14
140 0.13
141 0.12
142 0.1
143 0.1
144 0.06
145 0.07
146 0.07
147 0.06
148 0.06
149 0.1
150 0.15
151 0.16
152 0.15
153 0.15
154 0.15
155 0.17
156 0.17
157 0.14
158 0.12
159 0.1
160 0.11
161 0.12
162 0.13
163 0.15
164 0.18
165 0.22
166 0.26
167 0.35
168 0.36
169 0.45
170 0.54
171 0.56
172 0.55
173 0.54
174 0.5
175 0.44
176 0.44
177 0.35
178 0.31
179 0.25
180 0.25
181 0.22
182 0.19
183 0.17
184 0.15
185 0.14
186 0.07
187 0.08
188 0.06
189 0.05
190 0.06
191 0.06
192 0.06
193 0.09
194 0.09
195 0.09
196 0.1
197 0.1
198 0.1
199 0.16
200 0.23
201 0.27
202 0.33
203 0.4
204 0.47
205 0.55
206 0.63
207 0.67
208 0.71
209 0.76
210 0.81
211 0.8
212 0.82
213 0.78
214 0.77
215 0.72
216 0.65
217 0.58
218 0.55
219 0.49
220 0.43
221 0.39
222 0.33
223 0.28
224 0.24
225 0.2
226 0.18
227 0.18
228 0.15
229 0.15
230 0.14
231 0.13
232 0.14
233 0.14
234 0.09
235 0.08
236 0.08
237 0.08
238 0.09
239 0.09
240 0.09
241 0.1
242 0.14
243 0.14
244 0.15
245 0.16
246 0.2
247 0.2
248 0.21
249 0.21
250 0.17
251 0.17
252 0.16
253 0.16
254 0.12
255 0.17
256 0.15
257 0.15
258 0.16
259 0.15
260 0.15
261 0.14
262 0.13
263 0.08
264 0.11
265 0.11
266 0.09
267 0.09
268 0.1
269 0.11
270 0.15
271 0.15
272 0.12
273 0.17
274 0.23
275 0.26
276 0.32
277 0.31
278 0.32
279 0.34
280 0.37
281 0.34
282 0.36
283 0.37
284 0.33
285 0.32
286 0.28
287 0.26
288 0.26
289 0.24
290 0.15
291 0.1
292 0.08
293 0.1
294 0.1
295 0.11
296 0.07
297 0.08
298 0.09
299 0.11
300 0.12
301 0.1
302 0.11
303 0.12
304 0.13
305 0.18
306 0.18
307 0.21
308 0.22
309 0.22
310 0.21
311 0.21
312 0.2
313 0.2
314 0.22
315 0.21
316 0.19
317 0.22
318 0.26
319 0.31
320 0.41
321 0.46
322 0.53
323 0.6
324 0.68
325 0.74
326 0.8
327 0.86
328 0.87
329 0.87
330 0.9
331 0.89
332 0.92
333 0.86
334 0.8
335 0.76
336 0.69
337 0.59
338 0.5
339 0.41
340 0.32
341 0.29
342 0.24
343 0.19
344 0.16
345 0.17
346 0.15
347 0.13
348 0.12
349 0.12
350 0.17
351 0.18
352 0.2
353 0.2
354 0.22
355 0.22
356 0.22
357 0.23
358 0.18
359 0.16
360 0.14
361 0.12
362 0.1
363 0.1
364 0.1
365 0.12
366 0.13
367 0.14
368 0.13
369 0.21
370 0.26
371 0.28
372 0.32
373 0.34
374 0.42
375 0.5
376 0.58
377 0.6
378 0.61
379 0.61
380 0.65
381 0.67
382 0.66
383 0.66
384 0.63
385 0.57
386 0.61
387 0.61
388 0.54
389 0.57
390 0.54
391 0.51
392 0.53
393 0.5
394 0.45
395 0.46
396 0.47
397 0.41
398 0.4
399 0.36
400 0.28
401 0.28
402 0.27
403 0.23
404 0.2
405 0.18
406 0.14
407 0.13
408 0.13
409 0.15
410 0.12
411 0.13
412 0.14
413 0.14
414 0.21
415 0.26
416 0.28
417 0.27