Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316YBM9

Protein Details
Accession A0A316YBM9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MKEAVPTKKKEAQQRRKKKRRRGRKRKRGKEKGGQCVAEBasic
NLS Segment(s)
PositionSequence
8-33KKKEAQQRRKKKRRRGRKRKRGKEKG
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MKEAVPTKKKEAQQRRKKKRRRGRKRKRGKEKGGQCVAERALCARKTRLERERKICVSDEGSDVVCNGVWGVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.9
4 0.95
5 0.95
6 0.94
7 0.95
8 0.95
9 0.95
10 0.95
11 0.95
12 0.97
13 0.97
14 0.97
15 0.97
16 0.95
17 0.93
18 0.91
19 0.9
20 0.84
21 0.75
22 0.64
23 0.56
24 0.46
25 0.36
26 0.27
27 0.19
28 0.18
29 0.18
30 0.2
31 0.2
32 0.26
33 0.31
34 0.4
35 0.48
36 0.53
37 0.6
38 0.65
39 0.72
40 0.69
41 0.66
42 0.59
43 0.54
44 0.47
45 0.4
46 0.35
47 0.27
48 0.25
49 0.21
50 0.19
51 0.16
52 0.12
53 0.09