Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316YSQ8

Protein Details
Accession A0A316YSQ8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-123CVITKVKSDKDRRRIIARKSGKKEEDBasic
NLS Segment(s)
PositionSequence
107-120KDRRRIIARKSGKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MATTSRRTQRRNHFQAPSALKRKIMSSTLSKELRQEHGVRSLPVRRDDEVLIVRGTNKGREGRVVQVYRKKWVIHVDRVTRDKTNGTTVQLPVHPSNCVITKVKSDKDRRRIIARKSGKKEEDAEMKDSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.76
4 0.75
5 0.71
6 0.63
7 0.57
8 0.51
9 0.49
10 0.44
11 0.38
12 0.32
13 0.32
14 0.36
15 0.41
16 0.43
17 0.41
18 0.41
19 0.42
20 0.41
21 0.39
22 0.36
23 0.3
24 0.35
25 0.37
26 0.34
27 0.34
28 0.36
29 0.35
30 0.37
31 0.37
32 0.31
33 0.31
34 0.31
35 0.31
36 0.26
37 0.24
38 0.19
39 0.16
40 0.15
41 0.16
42 0.16
43 0.13
44 0.15
45 0.16
46 0.16
47 0.19
48 0.2
49 0.22
50 0.28
51 0.3
52 0.31
53 0.36
54 0.37
55 0.37
56 0.38
57 0.34
58 0.29
59 0.36
60 0.38
61 0.39
62 0.45
63 0.48
64 0.51
65 0.54
66 0.54
67 0.46
68 0.41
69 0.35
70 0.3
71 0.29
72 0.25
73 0.25
74 0.26
75 0.25
76 0.27
77 0.26
78 0.28
79 0.24
80 0.23
81 0.21
82 0.18
83 0.19
84 0.19
85 0.21
86 0.2
87 0.2
88 0.27
89 0.33
90 0.39
91 0.46
92 0.54
93 0.61
94 0.68
95 0.76
96 0.74
97 0.78
98 0.8
99 0.79
100 0.8
101 0.8
102 0.81
103 0.8
104 0.84
105 0.77
106 0.73
107 0.69
108 0.67
109 0.66
110 0.59