Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YYU2

Protein Details
Accession A0A316YYU2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33TPAAPSRSTARRRLRPPRASRQCCRRASLHydrophilic
NLS Segment(s)
PositionSequence
12-23STARRRLRPPRA
37-44RLPTKRRL
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MVRRTPAAPSRSTARRRLRPPRASRQCCRRASLVSRRLPTKRRLPRLRMPVVSLRPSWLASRQALPPSLPPPWPSSDLVLQPLLPDDLFKALSLPPSLLSSPSLTTRDPVPPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.72
4 0.8
5 0.83
6 0.84
7 0.88
8 0.89
9 0.9
10 0.89
11 0.88
12 0.88
13 0.87
14 0.81
15 0.75
16 0.68
17 0.63
18 0.64
19 0.65
20 0.63
21 0.61
22 0.61
23 0.62
24 0.64
25 0.63
26 0.61
27 0.61
28 0.62
29 0.66
30 0.71
31 0.72
32 0.75
33 0.79
34 0.79
35 0.69
36 0.63
37 0.59
38 0.54
39 0.49
40 0.4
41 0.32
42 0.26
43 0.25
44 0.22
45 0.18
46 0.17
47 0.16
48 0.18
49 0.19
50 0.2
51 0.2
52 0.19
53 0.19
54 0.19
55 0.2
56 0.18
57 0.18
58 0.19
59 0.22
60 0.24
61 0.23
62 0.23
63 0.24
64 0.24
65 0.25
66 0.22
67 0.19
68 0.16
69 0.15
70 0.13
71 0.1
72 0.09
73 0.07
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.12
80 0.13
81 0.13
82 0.12
83 0.14
84 0.15
85 0.15
86 0.16
87 0.15
88 0.17
89 0.21
90 0.22
91 0.2
92 0.21
93 0.24