Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YYL6

Protein Details
Accession A0A316YYL6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
123-165VEVKKAPKDWWKDKGNKKTPVIRYKERMLKKAIRNRERLKGNQHydrophilic
NLS Segment(s)
PositionSequence
126-168KKAPKDWWKDKGNKKTPVIRYKERMLKKAIRNRERLKGNQPKK
Subcellular Location(s) nucl 18.5, mito_nucl 12.833, cyto_nucl 11.166, mito 5
Family & Domain DBs
Amino Acid Sequences MDDEVKIRWQTFNDVLRRPITKAVKKAVDDNISMSNAVKSHGSNTLNKAPPSWVVSAVDNPYGPIEKRAYFKRPEEVAFVSTWANKERHKVASSRSKYELDFMIFDSSTRRWIMKPDITSGKVEVKKAPKDWWKDKGNKKTPVIRYKERMLKKAIRNRERLKGNQPKKTHLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.49
4 0.49
5 0.45
6 0.47
7 0.48
8 0.49
9 0.52
10 0.57
11 0.59
12 0.58
13 0.62
14 0.6
15 0.54
16 0.47
17 0.43
18 0.38
19 0.31
20 0.3
21 0.25
22 0.18
23 0.15
24 0.15
25 0.13
26 0.1
27 0.12
28 0.18
29 0.2
30 0.22
31 0.28
32 0.36
33 0.4
34 0.39
35 0.38
36 0.33
37 0.33
38 0.33
39 0.28
40 0.21
41 0.17
42 0.18
43 0.2
44 0.2
45 0.18
46 0.15
47 0.14
48 0.13
49 0.13
50 0.12
51 0.12
52 0.14
53 0.15
54 0.2
55 0.24
56 0.29
57 0.32
58 0.34
59 0.38
60 0.38
61 0.36
62 0.36
63 0.33
64 0.29
65 0.24
66 0.22
67 0.16
68 0.14
69 0.14
70 0.13
71 0.14
72 0.13
73 0.17
74 0.19
75 0.23
76 0.24
77 0.25
78 0.29
79 0.37
80 0.4
81 0.41
82 0.41
83 0.39
84 0.37
85 0.37
86 0.32
87 0.23
88 0.2
89 0.17
90 0.15
91 0.13
92 0.13
93 0.14
94 0.12
95 0.13
96 0.14
97 0.14
98 0.12
99 0.17
100 0.24
101 0.27
102 0.29
103 0.32
104 0.37
105 0.38
106 0.38
107 0.36
108 0.37
109 0.34
110 0.34
111 0.34
112 0.36
113 0.4
114 0.42
115 0.48
116 0.47
117 0.54
118 0.61
119 0.64
120 0.66
121 0.7
122 0.77
123 0.8
124 0.82
125 0.81
126 0.8
127 0.81
128 0.81
129 0.81
130 0.79
131 0.77
132 0.74
133 0.74
134 0.77
135 0.75
136 0.7
137 0.69
138 0.7
139 0.71
140 0.75
141 0.76
142 0.76
143 0.79
144 0.8
145 0.81
146 0.8
147 0.78
148 0.79
149 0.79
150 0.8
151 0.79
152 0.77