Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YAE1

Protein Details
Accession A0A316YAE1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPRLPKRAKERERERKRCAQRHKLIQAWPKLBasic
NLS Segment(s)
PositionSequence
5-17PKRAKERERERKR
116-122PRRESAR
127-140REVDGRGVRRERRG
Subcellular Location(s) mito 19, cyto 5, nucl 3
Family & Domain DBs
Amino Acid Sequences MPRLPKRAKERERERKRCAQRHKLIQAWPKLQASLVRTRSLAPGGGTPSTARFVGVAVAVVVDAGAKHTEMGNVTGRVALREDKIDAASRQAGAVASQCFVGFKNPRGCVHLTRRPRRESARWLAAREVDGRGVRRERRGSRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.91
4 0.9
5 0.9
6 0.9
7 0.88
8 0.89
9 0.89
10 0.85
11 0.82
12 0.8
13 0.78
14 0.7
15 0.65
16 0.55
17 0.47
18 0.41
19 0.37
20 0.33
21 0.34
22 0.34
23 0.3
24 0.3
25 0.3
26 0.31
27 0.28
28 0.25
29 0.16
30 0.15
31 0.16
32 0.16
33 0.15
34 0.13
35 0.14
36 0.14
37 0.13
38 0.1
39 0.08
40 0.08
41 0.08
42 0.07
43 0.06
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.02
50 0.02
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.08
59 0.09
60 0.09
61 0.09
62 0.1
63 0.1
64 0.1
65 0.11
66 0.1
67 0.09
68 0.1
69 0.1
70 0.1
71 0.11
72 0.13
73 0.12
74 0.13
75 0.13
76 0.12
77 0.11
78 0.11
79 0.1
80 0.08
81 0.11
82 0.09
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.15
89 0.16
90 0.22
91 0.3
92 0.33
93 0.35
94 0.38
95 0.42
96 0.43
97 0.49
98 0.52
99 0.55
100 0.62
101 0.68
102 0.7
103 0.74
104 0.74
105 0.73
106 0.74
107 0.73
108 0.73
109 0.69
110 0.66
111 0.62
112 0.56
113 0.5
114 0.43
115 0.35
116 0.29
117 0.29
118 0.29
119 0.33
120 0.38
121 0.42
122 0.48
123 0.56
124 0.59