Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316YWT4

Protein Details
Accession A0A316YWT4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-49AGLPCRRCRRCCCCCCRRRRRSGISAVYAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MGSFRPAKLHRTTSMDWSSLAGLPCRRCRRCCCCCCRRRRRSGISAVYAGVCVSAHSPCRALVWSDRVKWAVRAEPCRSDERVLGWSIARLCRSLSPVASFFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.39
4 0.35
5 0.31
6 0.26
7 0.25
8 0.2
9 0.21
10 0.26
11 0.35
12 0.44
13 0.48
14 0.51
15 0.6
16 0.66
17 0.72
18 0.77
19 0.77
20 0.78
21 0.82
22 0.87
23 0.89
24 0.89
25 0.89
26 0.89
27 0.88
28 0.85
29 0.86
30 0.81
31 0.73
32 0.64
33 0.53
34 0.43
35 0.34
36 0.25
37 0.15
38 0.08
39 0.05
40 0.05
41 0.05
42 0.06
43 0.07
44 0.08
45 0.08
46 0.09
47 0.1
48 0.11
49 0.13
50 0.2
51 0.24
52 0.25
53 0.27
54 0.28
55 0.28
56 0.29
57 0.29
58 0.28
59 0.3
60 0.35
61 0.38
62 0.42
63 0.45
64 0.46
65 0.45
66 0.41
67 0.36
68 0.32
69 0.31
70 0.26
71 0.24
72 0.2
73 0.21
74 0.22
75 0.24
76 0.22
77 0.19
78 0.2
79 0.22
80 0.25
81 0.26
82 0.25
83 0.27