Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YEP2

Protein Details
Accession A0A316YEP2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
159-186TTVTTKLKTHGHQKRHRRRLDSNVIHISHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, E.R. 3, golg 3, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009009  RlpA-like_DPBB  
IPR036908  RlpA-like_sf  
Pfam View protein in Pfam  
PF03330  DPBB_1  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MRAHNFLAIVVLGTTTVLCVPRPLLSTSSSSLSSELLPRNSYVHPASLKAKKHEKQQVATVITWYDGESLKEPACGVKEPKDSDNIAAVPESWGLGWCGKDIALQKGEKSVVVRVVDLCGSCKNESHFDLSKGAFKQLADLNEGELHDVTWSVNEASSTTVTTKLKTHGHQKRHRRRLDSNVIHIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.07
5 0.07
6 0.08
7 0.1
8 0.13
9 0.15
10 0.17
11 0.18
12 0.19
13 0.23
14 0.24
15 0.25
16 0.23
17 0.21
18 0.2
19 0.19
20 0.17
21 0.19
22 0.21
23 0.2
24 0.2
25 0.21
26 0.23
27 0.23
28 0.26
29 0.22
30 0.22
31 0.21
32 0.23
33 0.3
34 0.34
35 0.38
36 0.41
37 0.5
38 0.49
39 0.58
40 0.64
41 0.64
42 0.6
43 0.63
44 0.63
45 0.56
46 0.52
47 0.43
48 0.34
49 0.27
50 0.24
51 0.17
52 0.11
53 0.08
54 0.09
55 0.09
56 0.11
57 0.11
58 0.11
59 0.11
60 0.11
61 0.12
62 0.13
63 0.14
64 0.18
65 0.23
66 0.25
67 0.26
68 0.29
69 0.28
70 0.26
71 0.26
72 0.2
73 0.15
74 0.13
75 0.12
76 0.08
77 0.08
78 0.07
79 0.04
80 0.04
81 0.05
82 0.06
83 0.06
84 0.05
85 0.06
86 0.06
87 0.08
88 0.1
89 0.13
90 0.15
91 0.15
92 0.15
93 0.18
94 0.18
95 0.16
96 0.16
97 0.14
98 0.15
99 0.15
100 0.15
101 0.13
102 0.14
103 0.14
104 0.13
105 0.13
106 0.11
107 0.13
108 0.13
109 0.15
110 0.16
111 0.19
112 0.21
113 0.26
114 0.26
115 0.25
116 0.28
117 0.27
118 0.3
119 0.27
120 0.27
121 0.22
122 0.2
123 0.22
124 0.22
125 0.22
126 0.19
127 0.19
128 0.19
129 0.19
130 0.19
131 0.16
132 0.12
133 0.11
134 0.09
135 0.09
136 0.07
137 0.06
138 0.07
139 0.06
140 0.07
141 0.07
142 0.07
143 0.09
144 0.1
145 0.11
146 0.11
147 0.16
148 0.17
149 0.19
150 0.21
151 0.25
152 0.31
153 0.35
154 0.45
155 0.49
156 0.59
157 0.67
158 0.76
159 0.82
160 0.86
161 0.89
162 0.87
163 0.86
164 0.87
165 0.88
166 0.85