Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8PE08

Protein Details
Accession A8PE08   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-29GEQHLKKATRRSNRLQPEPKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 3
Family & Domain DBs
KEGG cci:CC1G_09752  -  
Amino Acid Sequences MPPKNKASGEQHLKKATRRSNRLQPEPKAPEPLPEPLKIRIIRAVVDTAPSHEEASNRSTPAPSAHQEKRQRNDGREEYVDAGDEHEKLKEIPEDYRLPFQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.68
4 0.68
5 0.69
6 0.7
7 0.72
8 0.78
9 0.83
10 0.82
11 0.78
12 0.77
13 0.77
14 0.7
15 0.67
16 0.57
17 0.51
18 0.45
19 0.47
20 0.39
21 0.35
22 0.35
23 0.3
24 0.37
25 0.33
26 0.32
27 0.28
28 0.26
29 0.24
30 0.22
31 0.21
32 0.14
33 0.16
34 0.14
35 0.12
36 0.12
37 0.11
38 0.11
39 0.1
40 0.11
41 0.1
42 0.15
43 0.16
44 0.15
45 0.15
46 0.14
47 0.14
48 0.17
49 0.19
50 0.18
51 0.24
52 0.28
53 0.37
54 0.46
55 0.54
56 0.57
57 0.63
58 0.66
59 0.63
60 0.68
61 0.63
62 0.6
63 0.54
64 0.51
65 0.43
66 0.37
67 0.34
68 0.24
69 0.22
70 0.17
71 0.15
72 0.13
73 0.11
74 0.12
75 0.11
76 0.15
77 0.17
78 0.18
79 0.2
80 0.25
81 0.3
82 0.33