Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316YLA2

Protein Details
Accession A0A316YLA2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-115ALSKTDRKRVTERQHKKDIHFBasic
NLS Segment(s)
PositionSequence
83-119DLRPKQTRAIRRALSKTDRKRVTERQHKKDIHFGRRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MANKVKAHELQAKSKADLTKQLDELKRELLQLRVQKVAGGASSKLTRINGVRKSIARVLTVMNQKQRQNIREFYKNKKHLPLDLRPKQTRAIRRALSKTDRKRVTERQHKKDIHFGRRKYVLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.42
4 0.46
5 0.44
6 0.41
7 0.42
8 0.48
9 0.47
10 0.47
11 0.46
12 0.41
13 0.36
14 0.32
15 0.3
16 0.26
17 0.28
18 0.31
19 0.32
20 0.3
21 0.29
22 0.27
23 0.26
24 0.23
25 0.18
26 0.14
27 0.11
28 0.12
29 0.12
30 0.12
31 0.13
32 0.13
33 0.14
34 0.17
35 0.24
36 0.26
37 0.29
38 0.32
39 0.31
40 0.35
41 0.36
42 0.34
43 0.26
44 0.22
45 0.2
46 0.23
47 0.27
48 0.26
49 0.28
50 0.31
51 0.32
52 0.37
53 0.41
54 0.39
55 0.39
56 0.43
57 0.44
58 0.48
59 0.52
60 0.55
61 0.61
62 0.64
63 0.63
64 0.64
65 0.6
66 0.58
67 0.6
68 0.61
69 0.61
70 0.62
71 0.68
72 0.62
73 0.62
74 0.62
75 0.62
76 0.61
77 0.55
78 0.56
79 0.53
80 0.58
81 0.62
82 0.63
83 0.65
84 0.67
85 0.71
86 0.72
87 0.73
88 0.7
89 0.73
90 0.75
91 0.77
92 0.78
93 0.79
94 0.78
95 0.82
96 0.83
97 0.79
98 0.79
99 0.78
100 0.77
101 0.76
102 0.71
103 0.7
104 0.74