Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YEA8

Protein Details
Accession A0A316YEA8   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-61LADGAEKTKKKKKQPEPAAESKGSHydrophilic
86-106VSILAKEKKQKKKQGVSEEERHydrophilic
NLS Segment(s)
PositionSequence
43-77EKTKKKKKQPEPAAESKGSAAGGKEKEVPAKKRKA
91-98KEKKQKKK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MPTKKKESKAPAAAVPLDKGKAKASEIDDIFGGKTAPLADGAEKTKKKKKQPEPAAESKGSAAGGKEKEVPAKKRKAVDEIADPSVSILAKEKKQKKKQGVSEEERDFMDSRGKKRAMTDDGLRIFTEKELGINDESGGESGFSSLYSPRRTKDISTGTPLCPFDCDCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.38
4 0.32
5 0.29
6 0.26
7 0.24
8 0.24
9 0.23
10 0.27
11 0.27
12 0.33
13 0.32
14 0.31
15 0.28
16 0.26
17 0.25
18 0.19
19 0.16
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.11
28 0.15
29 0.23
30 0.27
31 0.33
32 0.41
33 0.48
34 0.57
35 0.65
36 0.72
37 0.75
38 0.82
39 0.86
40 0.86
41 0.87
42 0.83
43 0.73
44 0.62
45 0.51
46 0.41
47 0.3
48 0.22
49 0.14
50 0.13
51 0.13
52 0.13
53 0.16
54 0.16
55 0.22
56 0.27
57 0.34
58 0.37
59 0.44
60 0.47
61 0.5
62 0.51
63 0.5
64 0.48
65 0.44
66 0.42
67 0.37
68 0.35
69 0.29
70 0.27
71 0.21
72 0.18
73 0.15
74 0.09
75 0.09
76 0.11
77 0.15
78 0.24
79 0.33
80 0.43
81 0.52
82 0.61
83 0.68
84 0.74
85 0.79
86 0.81
87 0.81
88 0.77
89 0.77
90 0.7
91 0.61
92 0.51
93 0.44
94 0.34
95 0.26
96 0.27
97 0.22
98 0.23
99 0.3
100 0.31
101 0.31
102 0.33
103 0.4
104 0.37
105 0.38
106 0.4
107 0.39
108 0.4
109 0.4
110 0.37
111 0.3
112 0.26
113 0.21
114 0.19
115 0.11
116 0.1
117 0.1
118 0.12
119 0.12
120 0.12
121 0.12
122 0.1
123 0.11
124 0.1
125 0.09
126 0.07
127 0.06
128 0.06
129 0.05
130 0.05
131 0.06
132 0.09
133 0.15
134 0.22
135 0.25
136 0.26
137 0.32
138 0.35
139 0.37
140 0.44
141 0.47
142 0.46
143 0.52
144 0.54
145 0.51
146 0.54
147 0.52
148 0.42
149 0.36
150 0.32