Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RNY1

Protein Details
Accession D6RNY1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKPRRQRPRTTNFHFRAGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, nucl 9, cyto_mito 8.5, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cci:CC1G_14876  -  
Amino Acid Sequences MSKPRRQRPRTTNFHFRAGGTPSRLLWFGLGAIFAGWWSSPPTTDFHFRDGGNPSRLLWFALGAISASWWSSRRTTNIHFRAGGAPSRLLWFGLGAIFASWWSSDNEPTFSLKSGACVAISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.71
3 0.61
4 0.55
5 0.5
6 0.46
7 0.39
8 0.36
9 0.3
10 0.3
11 0.29
12 0.24
13 0.19
14 0.14
15 0.11
16 0.09
17 0.08
18 0.06
19 0.05
20 0.05
21 0.04
22 0.04
23 0.03
24 0.04
25 0.06
26 0.06
27 0.07
28 0.08
29 0.11
30 0.14
31 0.21
32 0.22
33 0.23
34 0.26
35 0.25
36 0.27
37 0.3
38 0.32
39 0.27
40 0.26
41 0.24
42 0.22
43 0.22
44 0.19
45 0.14
46 0.09
47 0.07
48 0.07
49 0.06
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.07
58 0.1
59 0.12
60 0.15
61 0.2
62 0.26
63 0.36
64 0.4
65 0.42
66 0.4
67 0.39
68 0.39
69 0.36
70 0.33
71 0.25
72 0.2
73 0.17
74 0.19
75 0.17
76 0.14
77 0.12
78 0.09
79 0.08
80 0.08
81 0.07
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.08
90 0.1
91 0.14
92 0.16
93 0.19
94 0.2
95 0.23
96 0.23
97 0.22
98 0.23
99 0.19
100 0.2
101 0.2
102 0.2