Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YR41

Protein Details
Accession A0A316YR41   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-73LFERAKMRLKWKKKRMRRLRRKRRKMRQRLGSRASIBasic
NLS Segment(s)
PositionSequence
41-68RAKMRLKWKKKRMRRLRRKRRKMRQRLG
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MAHACPLRREGAPSVNELAVWPSRLLLLHSHRSHFPALFERAKMRLKWKKKRMRRLRRKRRKMRQRLGSRASIITSSSGRSSMNSRKSILCVINSNKPINVEPEVNVGSSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.29
4 0.25
5 0.24
6 0.17
7 0.17
8 0.14
9 0.11
10 0.11
11 0.12
12 0.13
13 0.16
14 0.21
15 0.29
16 0.31
17 0.33
18 0.34
19 0.36
20 0.37
21 0.31
22 0.27
23 0.24
24 0.28
25 0.28
26 0.28
27 0.27
28 0.3
29 0.33
30 0.32
31 0.37
32 0.4
33 0.49
34 0.58
35 0.67
36 0.72
37 0.79
38 0.88
39 0.89
40 0.91
41 0.92
42 0.93
43 0.94
44 0.95
45 0.96
46 0.96
47 0.96
48 0.96
49 0.96
50 0.95
51 0.94
52 0.93
53 0.91
54 0.85
55 0.78
56 0.69
57 0.58
58 0.49
59 0.38
60 0.28
61 0.21
62 0.16
63 0.13
64 0.11
65 0.11
66 0.11
67 0.12
68 0.18
69 0.24
70 0.31
71 0.33
72 0.35
73 0.36
74 0.38
75 0.42
76 0.39
77 0.34
78 0.34
79 0.36
80 0.43
81 0.46
82 0.45
83 0.4
84 0.4
85 0.38
86 0.35
87 0.34
88 0.27
89 0.24
90 0.28
91 0.27