Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YK58

Protein Details
Accession A0A316YK58    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-71VRERRAARHVRSSRKSRRKKIKIVLNFLFFHydrophilic
NLS Segment(s)
PositionSequence
42-63VRERRAARHVRSSRKSRRKKIK
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MNPLLLVSMVCWRVRVSHRYPQQGVAMRSFSRSSVLGEARSVRERRAARHVRSSRKSRRKKIKIVLNFLFFLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.33
3 0.34
4 0.41
5 0.48
6 0.56
7 0.57
8 0.54
9 0.55
10 0.54
11 0.5
12 0.43
13 0.38
14 0.3
15 0.31
16 0.28
17 0.21
18 0.17
19 0.15
20 0.14
21 0.15
22 0.15
23 0.14
24 0.14
25 0.15
26 0.16
27 0.21
28 0.2
29 0.17
30 0.24
31 0.25
32 0.28
33 0.38
34 0.44
35 0.43
36 0.54
37 0.61
38 0.64
39 0.71
40 0.78
41 0.78
42 0.8
43 0.87
44 0.87
45 0.9
46 0.9
47 0.92
48 0.92
49 0.91
50 0.9
51 0.89
52 0.86
53 0.79