Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YP55

Protein Details
Accession A0A316YP55   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-121QRKIANPGRRSRNPRQRRRCRRPLLLLEYRVHydrophilic
NLS Segment(s)
PositionSequence
75-112LARKRAKGGKKDMEAEQRKIANPGRRSRNPRQRRRCRR
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MSARIMMKERTWAARGRKIGGEVASEQEENREEDADVACRTPLPGQQGPRSRIKVAGIAATRPILLLRATFDIRLARKRAKGGKKDMEAEQRKIANPGRRSRNPRQRRRCRRPLLLLEYRVVFPPRIARRTPCLLPSLSAPPTPPFVSQKYLISRGPTGQETRSPFFMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.48
4 0.47
5 0.44
6 0.45
7 0.39
8 0.34
9 0.28
10 0.27
11 0.26
12 0.23
13 0.2
14 0.19
15 0.19
16 0.17
17 0.17
18 0.14
19 0.12
20 0.13
21 0.15
22 0.15
23 0.14
24 0.12
25 0.12
26 0.11
27 0.11
28 0.12
29 0.13
30 0.18
31 0.22
32 0.27
33 0.35
34 0.43
35 0.46
36 0.52
37 0.53
38 0.46
39 0.44
40 0.41
41 0.36
42 0.3
43 0.31
44 0.24
45 0.21
46 0.21
47 0.19
48 0.17
49 0.13
50 0.12
51 0.07
52 0.07
53 0.06
54 0.07
55 0.1
56 0.1
57 0.1
58 0.11
59 0.14
60 0.16
61 0.21
62 0.23
63 0.25
64 0.27
65 0.33
66 0.41
67 0.46
68 0.51
69 0.56
70 0.59
71 0.58
72 0.58
73 0.57
74 0.58
75 0.53
76 0.48
77 0.44
78 0.38
79 0.35
80 0.36
81 0.37
82 0.34
83 0.36
84 0.42
85 0.47
86 0.53
87 0.62
88 0.68
89 0.74
90 0.78
91 0.83
92 0.86
93 0.88
94 0.92
95 0.94
96 0.94
97 0.92
98 0.9
99 0.89
100 0.87
101 0.85
102 0.81
103 0.73
104 0.64
105 0.56
106 0.47
107 0.39
108 0.31
109 0.22
110 0.15
111 0.22
112 0.28
113 0.31
114 0.33
115 0.35
116 0.4
117 0.47
118 0.48
119 0.42
120 0.38
121 0.35
122 0.33
123 0.33
124 0.33
125 0.28
126 0.26
127 0.25
128 0.23
129 0.27
130 0.27
131 0.27
132 0.26
133 0.27
134 0.31
135 0.32
136 0.36
137 0.38
138 0.42
139 0.4
140 0.4
141 0.39
142 0.38
143 0.4
144 0.38
145 0.35
146 0.34
147 0.38
148 0.4
149 0.42