Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YJU3

Protein Details
Accession A0A316YJU3   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-41ADTKAPPAPRRQRRRGSVIVKHydrophilic
NLS Segment(s)
PositionSequence
13-35RRRGGATAADTKAPPAPRRQRRR
Subcellular Location(s) plas 11, mito 10, cyto 3, nucl 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024512  Ser_palmitoyltrfase_ssu-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF11779  SPT_ssu-like  
Amino Acid Sequences MEQHSTDSSTLRRRRGGATAADTKAPPAPRRQRRRGSVIVKHVWPYYIWFEGTFSLAMLEFWEKCLFFAIFSALTLLVSYYLVFHLAANARFILKRTMYYLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.5
4 0.46
5 0.47
6 0.48
7 0.45
8 0.44
9 0.4
10 0.35
11 0.34
12 0.32
13 0.28
14 0.31
15 0.4
16 0.49
17 0.59
18 0.68
19 0.73
20 0.76
21 0.81
22 0.8
23 0.79
24 0.76
25 0.75
26 0.69
27 0.61
28 0.56
29 0.48
30 0.39
31 0.3
32 0.25
33 0.19
34 0.16
35 0.14
36 0.12
37 0.12
38 0.12
39 0.13
40 0.1
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.05
48 0.07
49 0.08
50 0.08
51 0.08
52 0.11
53 0.1
54 0.09
55 0.09
56 0.1
57 0.09
58 0.09
59 0.09
60 0.07
61 0.07
62 0.07
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.09
73 0.13
74 0.14
75 0.15
76 0.15
77 0.17
78 0.17
79 0.19
80 0.22
81 0.19
82 0.21
83 0.24