Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YPA1

Protein Details
Accession A0A316YPA1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
127-153VRASRGGRVRWRTRRESPGRDRRPSPSBasic
NLS Segment(s)
PositionSequence
126-161HVRASRGGRVRWRTRRESPGRDRRPSPSSLRRGLRR
Subcellular Location(s) mito 16.5, cyto_mito 10.333, nucl 4.5, cyto_nucl 4.333, cyto 3
Family & Domain DBs
Amino Acid Sequences MSRSFLHLSAMTYPYVCSTCASTRSGSRTGVTGPSTGACRGGRGQAGTMDTSGTPVSGVSDGLTVDWEGAGNAAHPSNLASGIYYRPILQPCVPYEDCPPTDERTKSQPGRAEGKKGGDYSWRTSHVRASRGGRVRWRTRRESPGRDRRPSPSSLRRGLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.12
5 0.15
6 0.19
7 0.22
8 0.24
9 0.24
10 0.28
11 0.33
12 0.35
13 0.32
14 0.28
15 0.27
16 0.27
17 0.28
18 0.25
19 0.2
20 0.17
21 0.17
22 0.18
23 0.17
24 0.19
25 0.15
26 0.15
27 0.16
28 0.19
29 0.19
30 0.18
31 0.19
32 0.17
33 0.19
34 0.17
35 0.16
36 0.13
37 0.11
38 0.11
39 0.1
40 0.07
41 0.06
42 0.05
43 0.06
44 0.05
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.04
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.09
74 0.1
75 0.13
76 0.13
77 0.16
78 0.16
79 0.23
80 0.23
81 0.22
82 0.24
83 0.27
84 0.26
85 0.25
86 0.26
87 0.22
88 0.28
89 0.28
90 0.27
91 0.29
92 0.37
93 0.39
94 0.41
95 0.44
96 0.42
97 0.5
98 0.5
99 0.49
100 0.44
101 0.46
102 0.44
103 0.39
104 0.36
105 0.34
106 0.35
107 0.35
108 0.36
109 0.37
110 0.35
111 0.36
112 0.43
113 0.42
114 0.41
115 0.42
116 0.42
117 0.46
118 0.51
119 0.56
120 0.57
121 0.6
122 0.68
123 0.71
124 0.74
125 0.74
126 0.75
127 0.81
128 0.82
129 0.83
130 0.84
131 0.85
132 0.86
133 0.86
134 0.82
135 0.78
136 0.73
137 0.69
138 0.68
139 0.67
140 0.66
141 0.67