Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NVF9

Protein Details
Accession A8NVF9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-148EITRKEKAWRRERAQYQKRVRELEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
KEGG cci:CC1G_08088  -  
Amino Acid Sequences MREKENQAPLKKKSVSGAHRSGPQTSKTPRSSSRTSARAAKARISSHFEENGALDDFAESQAWIENLVDHKDLYIPPLPPVRQPSVQPKGLPLSTPLKSTSNAPTDVSTPTLEERVVELEGRMAEITRKEKAWRRERAQYQKRVRELEEEVSSTKRVLLDLANLFLRDAEVEPPSSVILDGGYLIRRGFVEHISHRFRNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.6
4 0.62
5 0.57
6 0.62
7 0.61
8 0.59
9 0.54
10 0.49
11 0.48
12 0.48
13 0.53
14 0.5
15 0.54
16 0.56
17 0.59
18 0.61
19 0.61
20 0.63
21 0.59
22 0.58
23 0.6
24 0.59
25 0.59
26 0.56
27 0.54
28 0.51
29 0.49
30 0.49
31 0.47
32 0.44
33 0.41
34 0.4
35 0.35
36 0.3
37 0.27
38 0.25
39 0.19
40 0.16
41 0.11
42 0.09
43 0.09
44 0.09
45 0.08
46 0.06
47 0.05
48 0.06
49 0.06
50 0.06
51 0.05
52 0.07
53 0.08
54 0.11
55 0.11
56 0.1
57 0.1
58 0.11
59 0.11
60 0.13
61 0.14
62 0.13
63 0.15
64 0.2
65 0.21
66 0.22
67 0.27
68 0.28
69 0.27
70 0.3
71 0.37
72 0.38
73 0.4
74 0.37
75 0.34
76 0.34
77 0.32
78 0.28
79 0.22
80 0.21
81 0.2
82 0.21
83 0.21
84 0.19
85 0.19
86 0.21
87 0.23
88 0.2
89 0.21
90 0.2
91 0.19
92 0.19
93 0.19
94 0.18
95 0.13
96 0.11
97 0.1
98 0.1
99 0.09
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.07
107 0.07
108 0.08
109 0.07
110 0.05
111 0.07
112 0.1
113 0.13
114 0.13
115 0.15
116 0.2
117 0.28
118 0.38
119 0.46
120 0.52
121 0.56
122 0.64
123 0.73
124 0.79
125 0.81
126 0.82
127 0.82
128 0.81
129 0.81
130 0.74
131 0.66
132 0.6
133 0.54
134 0.5
135 0.42
136 0.35
137 0.31
138 0.29
139 0.28
140 0.23
141 0.2
142 0.14
143 0.12
144 0.12
145 0.11
146 0.16
147 0.17
148 0.19
149 0.18
150 0.18
151 0.18
152 0.16
153 0.15
154 0.1
155 0.1
156 0.1
157 0.1
158 0.12
159 0.12
160 0.13
161 0.13
162 0.12
163 0.11
164 0.08
165 0.07
166 0.06
167 0.06
168 0.07
169 0.09
170 0.09
171 0.09
172 0.1
173 0.1
174 0.12
175 0.14
176 0.16
177 0.22
178 0.28
179 0.37
180 0.44