FuNGI

A0A316YY72

Protein Details

Accession

A0A316YY72

Localization Confidence

Medium

Confidence Score

11.1

NoLS Segment(s)

Position	Sequence	Protein Nature
100-125	RQTAEEKEAKRREKEKRMNREIGKSA	Basic

NLS Segment(s)

Position	Sequence
83-119	PPVAKHGMGAKFANAFKRQTAEEKEAKRREKEKRMNR

Subcellular Location(s)

extr 12, nucl 9.5, cyto_nucl 6.5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR013226 Pal1
Pfam	View protein in Pfam PF08316 Pal1

Amino Acid Sequences

MSRQRRPSGGQEAVLAALSDVVTVAPSTGEYSRGSGPAVIPDSSAAAYSGASPMAANEQAPAVPTKEDFDPLGPASRNPKAPPPVAKHGMGAKFANAFKRQTAEEKEAKRREKEKRMNREIGKSAYNSSRMDVIDRLDLSGLNGSLFHHDSPYDACSPHNNRNSKKAPVMAFDPNIDPMTGAPINRGGASNARAGNRPGLSPLAAATRRKMNDNAGELDDGKDAGLNSRTTTSSSNPSRRSQTAPLPLLNIDDTTFQATPSELDGTDASVASHSSVDRDVDAERAYHNQGYFHQASTTNKGRADAANPHADIWGVSSEPWQDFAQPASRSNLGAPSGGSGPASAASSVFDMEAVLTGKAPADAKIEDMGVGERAMGDNNHNGPKRSKSLIKRIKSARQYGNVPPPDDDVVEMSGMSSTQSAARAAAQRHNNRQHRHSPSVPQPPSMPRAHDGNLGRSGTLRAGSGNGASPRLDEDEYENIPSATQSYDDPAFASSAARSGGSSPGSPGAANMSRSGSIFGRFGRRNTNTNGGGTSPNGHGRSAKSRERESAALGMAR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.34
2	0.25
3	0.15
4	0.1
5	0.09
6	0.06
7	0.05
8	0.05
9	0.05
10	0.05
11	0.05
12	0.04
13	0.05
14	0.08
15	0.09
16	0.11
17	0.12
18	0.15
19	0.17
20	0.18
21	0.19
22	0.18
23	0.18
24	0.22
25	0.24
26	0.21
27	0.19
28	0.18
29	0.19
30	0.17
31	0.17
32	0.11
33	0.08
34	0.08
35	0.09
36	0.09
37	0.07
38	0.07
39	0.07
40	0.07
41	0.1
42	0.11
43	0.1
44	0.1
45	0.11
46	0.11
47	0.12
48	0.13
49	0.11
50	0.12
51	0.12
52	0.15
53	0.15
54	0.17
55	0.17
56	0.17
57	0.19
58	0.19
59	0.25
60	0.23
61	0.24
62	0.29
63	0.33
64	0.37
65	0.36
66	0.43
67	0.43
68	0.49
69	0.55
70	0.56
71	0.6
72	0.61
73	0.59
74	0.54
75	0.54
76	0.51
77	0.46
78	0.38
79	0.31
80	0.31
81	0.32
82	0.35
83	0.31
84	0.3
85	0.28
86	0.31
87	0.31
88	0.33
89	0.38
90	0.39
91	0.44
92	0.5
93	0.59
94	0.64
95	0.69
96	0.69
97	0.72
98	0.75
99	0.78
100	0.81
101	0.81
102	0.84
103	0.87
104	0.88
105	0.85
106	0.82
107	0.77
108	0.7
109	0.63
110	0.54
111	0.49
112	0.43
113	0.42
114	0.34
115	0.3
116	0.29
117	0.26
118	0.26
119	0.23
120	0.2
121	0.2
122	0.2
123	0.19
124	0.15
125	0.15
126	0.13
127	0.14
128	0.12
129	0.08
130	0.08
131	0.08
132	0.11
133	0.12
134	0.11
135	0.11
136	0.1
137	0.11
138	0.13
139	0.16
140	0.15
141	0.14
142	0.14
143	0.22
144	0.29
145	0.37
146	0.43
147	0.48
148	0.49
149	0.58
150	0.63
151	0.59
152	0.58
153	0.55
154	0.49
155	0.44
156	0.46
157	0.41
158	0.37
159	0.33
160	0.29
161	0.25
162	0.23
163	0.2
164	0.15
165	0.1
166	0.14
167	0.13
168	0.12
169	0.11
170	0.13
171	0.13
172	0.14
173	0.14
174	0.1
175	0.12
176	0.14
177	0.18
178	0.19
179	0.2
180	0.21
181	0.21
182	0.25
183	0.23
184	0.21
185	0.18
186	0.16
187	0.15
188	0.14
189	0.14
190	0.15
191	0.17
192	0.18
193	0.19
194	0.24
195	0.25
196	0.28
197	0.29
198	0.28
199	0.31
200	0.33
201	0.33
202	0.28
203	0.28
204	0.25
205	0.24
206	0.19
207	0.13
208	0.1
209	0.08
210	0.07
211	0.08
212	0.1
213	0.09
214	0.1
215	0.11
216	0.12
217	0.13
218	0.15
219	0.15
220	0.22
221	0.29
222	0.35
223	0.38
224	0.41
225	0.44
226	0.45
227	0.47
228	0.44
229	0.44
230	0.45
231	0.43
232	0.4
233	0.36
234	0.34
235	0.3
236	0.25
237	0.18
238	0.1
239	0.08
240	0.08
241	0.1
242	0.09
243	0.08
244	0.08
245	0.08
246	0.08
247	0.08
248	0.09
249	0.06
250	0.07
251	0.07
252	0.07
253	0.08
254	0.07
255	0.06
256	0.05
257	0.05
258	0.05
259	0.05
260	0.05
261	0.05
262	0.06
263	0.06
264	0.06
265	0.07
266	0.07
267	0.07
268	0.08
269	0.07
270	0.07
271	0.09
272	0.11
273	0.11
274	0.11
275	0.11
276	0.12
277	0.18
278	0.18
279	0.16
280	0.16
281	0.17
282	0.19
283	0.24
284	0.28
285	0.24
286	0.24
287	0.24
288	0.24
289	0.23
290	0.24
291	0.24
292	0.23
293	0.24
294	0.24
295	0.23
296	0.22
297	0.21
298	0.17
299	0.12
300	0.1
301	0.06
302	0.06
303	0.06
304	0.08
305	0.08
306	0.11
307	0.09
308	0.09
309	0.1
310	0.11
311	0.17
312	0.16
313	0.18
314	0.18
315	0.19
316	0.18
317	0.18
318	0.2
319	0.14
320	0.13
321	0.12
322	0.11
323	0.11
324	0.1
325	0.1
326	0.07
327	0.06
328	0.07
329	0.07
330	0.05
331	0.05
332	0.05
333	0.05
334	0.06
335	0.05
336	0.05
337	0.04
338	0.04
339	0.05
340	0.05
341	0.05
342	0.05
343	0.05
344	0.05
345	0.07
346	0.07
347	0.07
348	0.09
349	0.09
350	0.1
351	0.11
352	0.11
353	0.1
354	0.1
355	0.09
356	0.07
357	0.07
358	0.06
359	0.05
360	0.05
361	0.06
362	0.06
363	0.07
364	0.11
365	0.15
366	0.22
367	0.23
368	0.25
369	0.28
370	0.33
371	0.36
372	0.37
373	0.42
374	0.44
375	0.53
376	0.61
377	0.63
378	0.66
379	0.69
380	0.73
381	0.72
382	0.73
383	0.69
384	0.65
385	0.65
386	0.63
387	0.66
388	0.6
389	0.54
390	0.46
391	0.42
392	0.37
393	0.32
394	0.25
395	0.16
396	0.13
397	0.12
398	0.11
399	0.08
400	0.07
401	0.06
402	0.06
403	0.05
404	0.05
405	0.06
406	0.07
407	0.08
408	0.08
409	0.12
410	0.17
411	0.19
412	0.26
413	0.34
414	0.41
415	0.51
416	0.6
417	0.65
418	0.67
419	0.72
420	0.75
421	0.74
422	0.74
423	0.7
424	0.68
425	0.69
426	0.74
427	0.68
428	0.6
429	0.56
430	0.53
431	0.54
432	0.48
433	0.42
434	0.33
435	0.36
436	0.36
437	0.39
438	0.37
439	0.36
440	0.39
441	0.36
442	0.33
443	0.29
444	0.28
445	0.22
446	0.21
447	0.16
448	0.1
449	0.11
450	0.12
451	0.12
452	0.15
453	0.15
454	0.16
455	0.16
456	0.15
457	0.16
458	0.19
459	0.18
460	0.15
461	0.18
462	0.22
463	0.23
464	0.24
465	0.23
466	0.19
467	0.19
468	0.18
469	0.15
470	0.1
471	0.09
472	0.09
473	0.12
474	0.14
475	0.14
476	0.14
477	0.14
478	0.14
479	0.13
480	0.13
481	0.09
482	0.1
483	0.1
484	0.1
485	0.09
486	0.1
487	0.15
488	0.15
489	0.16
490	0.16
491	0.18
492	0.18
493	0.18
494	0.16
495	0.19
496	0.21
497	0.22
498	0.22
499	0.22
500	0.22
501	0.23
502	0.25
503	0.2
504	0.19
505	0.2
506	0.23
507	0.3
508	0.32
509	0.35
510	0.42
511	0.46
512	0.49
513	0.53
514	0.58
515	0.51
516	0.5
517	0.49
518	0.41
519	0.38
520	0.34
521	0.31
522	0.26
523	0.3
524	0.29
525	0.28
526	0.3
527	0.33
528	0.42
529	0.46
530	0.51
531	0.51
532	0.56
533	0.61
534	0.63
535	0.6
536	0.54
537	0.51

A0A316YY72

3D AlphaFold-predicted Structure Viewer